DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and F32A5.8

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_495516.2 Gene:F32A5.8 / 353400 WormBaseID:WBGene00017971 Length:257 Species:Caenorhabditis elegans


Alignment Length:213 Identity:72/213 - (33%)
Similarity:107/213 - (50%) Gaps:14/213 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSREL 101
            |:.|.:||.:.:||..:|||.|||..:|.:|..|.:..|::...||.:|.|.:|..:..|.....
 Worm    30 KEIDLSGKTYAITGTTSGIGIETARALALKGAHVVMFNRNIVESEKLKKRIEEEKPDVKIDFISC 94

  Fly   102 DLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDVL 166
            ||:||.|.:...|.|..:...||.||.||||.......|.|.:|...||||:..|||...||..|
 Worm    95 DLNSLQSAKAAADEFLSKHWPLHGLILNAGVFAPTVKFTFDNFESHFGVNHLAQFLLAKELLPAL 159

  Fly   167 KNSAPSRIVVVSSLAHARGSINVADLNSEK-----------SYDEGLAYSQSKLANVLFTRELAK 220
            :.|:|:|||.|||::.:...:......|||           .|.:  .|:.||:..||...::.:
 Worm   160 RQSSPARIVFVSSVSSSHTGLKAEMTRSEKLNKLCPENANEFYYK--LYAYSKMCQVLTAFKIHR 222

  Fly   221 -RLEGSGVTVNALHPGVV 237
             .....|::..|:|||.:
 Worm   223 DEFVSHGISTYAIHPGTM 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 71/210 (34%)
NADB_Rossmann 43..317 CDD:304358 70/207 (34%)
F32A5.8NP_495516.2 NADB_Rossmann 36..>245 CDD:304358 70/207 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.