DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and CG6012

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster


Alignment Length:270 Identity:63/270 - (23%)
Similarity:100/270 - (37%) Gaps:70/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CLLSPLIMWPATIGVGIYFLKEYMQ---------------GGKFTKDT--DETGKVFIVTGANTG 54
            |.||..:.:     ||:|.|..|:.               .|  |:.|  :..|....||||:.|
  Fly     3 CALSAFLTF-----VGVYALSSYLYEQLRTPYKLIKIRYFSG--TRPTLKERFGDWAAVTGASDG 60

  Fly    55 IGKETALEIARRGGTVYLACRDMNRCEKARKDIIK-----ETNNQNIFSRELDLSSLDSIRKFVD 114
            ||||.|.|:||:...|.|..|...:.:...|:|..     :|        ::.::......:..:
  Fly    61 IGKEYAKELARQNINVVLIARTEEKLQAVAKEIADCGAGVQT--------KIVIADFTKGSQVYE 117

  Fly   115 GFKKEQPK--LHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDVLKNSAPSRIVVV 177
            ..:||...  :.:|:||.|: ..||:|.|...|                   ..:|...:.:|.|
  Fly   118 HIEKETANIPISILVNNVGI-ATPKSLLKYNQE-------------------ETQNIIDTNVVAV 162

  Fly   178 SSLAH----------ARGSI-NVADLNSEKSYDEGLAYSQSKLANVLFTRELAKRLEGSGVTVNA 231
            |.|:.          .:|:| ||......:....|..|:.||......|..|....:..|:.|..
  Fly   163 SQLSRIFFQRMKASKLKGAIVNVGSGTELQPLPNGAYYAASKAYTRSLTLALYHEAKPYGIHVQM 227

  Fly   232 LHPGVVDTEL 241
            |.|..|.|::
  Fly   228 LSPNFVVTKI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 52/220 (24%)
NADB_Rossmann 43..317 CDD:304358 52/217 (24%)
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 52/217 (24%)
adh_short 51..243 CDD:278532 51/215 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.