DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and CG13284

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001260523.1 Gene:CG13284 / 35021 FlyBaseID:FBgn0032614 Length:339 Species:Drosophila melanogaster


Alignment Length:317 Identity:73/317 - (23%)
Similarity:125/317 - (39%) Gaps:62/317 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IFIDCLLSPLIMWP-----------ATIGVGIY------------FLKEYMQGGKFTKDTDETGK 44
            :.|..||....:|.           .||||.:|            .|:.|.|........|:.|:
  Fly     7 VSIYTLLKMAFIWQLISAAIYLVGLLTIGVFLYDNLKSLVSIIKAVLEPYFQPHLPRTLVDKFGQ 71

  Fly    45 VFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETN---NQNIFSRELDLSSL 106
            ..:||||..|||||.|.|:||:|..:.|..|       .::.:|..||   :|.....:...:..
  Fly    72 WAVVTGATDGIGKEYARELARQGINLVLISR-------TKEKLIAVTNEIESQYKVKTKWIAADF 129

  Fly   107 DSIRKFVDGFKKEQPKLHV--LINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLL-LDVLKN 168
            ...|:..|..:||...:.|  |:||.|:|          ||....::.:...||.||| :::...
  Fly   130 AKGREVYDQIEKELAGIDVGILVNNVGMM----------YEHPESLDLVSEDLLWNLLTVNMGSV 184

  Fly   169 SAPSRIVVVSSLAHARGSI-NVADLNSEKSYDEGLAYSQSKLANVLFTRELAKRLEGSGVTVNAL 232
            :..:|.::...:...:|:| |:...:..:.......|:.||.....|::.|...:....:.|..:
  Fly   185 TMLTRKILPQMIGRRKGAIVNLGSSSELQPLPNMTVYAASKKFVTYFSKALELEVAEHNIHVQLV 249

  Fly   233 HPGVVDTEL-------ARNWAFFQTNLVKFFLKPMIWPLLKTPKS------GAQTSI 276
            .|..|.|::       .:...||.....  |.:..::.|.||.::      |.|.:|
  Fly   250 MPNFVVTKMNAYTDRVMQGGLFFPNAYT--FARSAVFTLGKTSETNGFWTHGIQYAI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 61/257 (24%)
NADB_Rossmann 43..317 CDD:304358 60/254 (24%)
CG13284NP_001260523.1 DltE 70..323 CDD:223377 60/254 (24%)
17beta-HSD1_like_SDR_c 70..309 CDD:187614 60/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447695
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.