DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and cbr1l

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_919360.1 Gene:cbr1l / 337696 ZFINID:ZDB-GENE-030131-9642 Length:277 Species:Danio rerio


Alignment Length:282 Identity:73/282 - (25%)
Similarity:115/282 - (40%) Gaps:68/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KVFIVTGANTGIGKETALEIARRG--GTVYLACRDMNRCEKARKDIIKETNNQ---NIFSRELDL 103
            ||.:|||||.|||......:.:.|  |.:.|..|:    ||..::.|....::   |:...:||:
Zfish     4 KVAVVTGANKGIGLAIVKGLCKAGFTGDILLTARN----EKLGQEAIAGLQSEGFKNVVFHQLDI 64

  Fly   104 SSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGY----ELQLGVNHIGHFLLTNLLLD 164
            ....|..|.....:::...|.|||||||:  ..|....:.:    |:.:..|..|.....:.||.
Zfish    65 CDQGSCMKLKKFLEEKYGGLDVLINNAGI--AFKNAATEPFGEQAEVTMRTNFWGTLWACHALLP 127

  Fly   165 VLKNSAPSRIVVVS------SLAHARGSINVADLNSEKSYDE----------------------- 200
            :|:  |.:|:|.||      ||......:.....|.:.|.:|                       
Zfish   128 ILR--ANARVVNVSSFVSKKSLDQCSAELQAKFRNKDLSEEELCLLMGEFVQDAQAGDHSAKGWP 190

  Fly   201 GLAYSQSKLANVLFTRELAKRLE----GSGVTVNALHPGVVDTELARNWAFFQTNLVKFFLKPMI 261
            ..||..:|:...:.:|..|:.|.    |.|:.:||..||.|.|::|...|               
Zfish   191 NTAYGTTKIGVTVLSRIQARVLNETRPGDGILLNACCPGWVRTDMAGPKA--------------- 240

  Fly   262 WPLLKTPKSGAQTSIYAALDPE 283
             |  |:|:.||:|.:|.|:.||
Zfish   241 -P--KSPEEGAETPVYLAMLPE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 73/282 (26%)
NADB_Rossmann 43..317 CDD:304358 73/282 (26%)
cbr1lNP_919360.1 carb_red_PTCR-like_SDR_c 4..277 CDD:187585 73/282 (26%)
adh_short 4..242 CDD:278532 64/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.