DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and CG15629

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_608859.1 Gene:CG15629 / 33679 FlyBaseID:FBgn0031630 Length:325 Species:Drosophila melanogaster


Alignment Length:259 Identity:56/259 - (21%)
Similarity:107/259 - (41%) Gaps:46/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IYFLKEYMQGG----KFTKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNR-CEK 82
            :|::.|.:...    :|.|..|.:|:|.::||...|:|:..||..||....:.:  .|:|: ..|
  Fly    32 VYYVLESIYYSLLPQRFRKLKDISGQVVLITGGGGGVGRLIALNFARLQARIVI--WDINQEAIK 94

  Fly    83 ARKDIIKETNNQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQ 147
            ...|::.:....|.....:|:|..:.|.:......:|...:.:||||||::.|     |..:||.
  Fly    95 TTVDLLAKHGYDNCKGYVVDISDREQIYQRASQVTEEVGPVDILINNAGIVCC-----KPFWELH 154

  Fly   148 -------LGVNHIGHFLLTNLLLDVLKNSAPSRIVVVSSLAHARGSINVADLNSEKSYDEGLAYS 205
                   ..:|.|.|:......|..:..:....||.|.|:....|:...:|            |:
  Fly   155 DRVIQNTYNINIISHYWTVKAFLPHMMRNNRGHIVTVGSVTGMLGTYGCSD------------YA 207

  Fly   206 QSKLANVLFTRELAKRLEGSG---VTVNALHPGVVDTELARNWAFFQTNLVKFFLKPMIWPLLK 266
            .:|.|.:.|...|...|:..|   :.::.:.|..::|.:...            ::|.:.|:|:
  Fly   208 ATKYACIGFHESLLTDLKAHGYDQIQMSLICPYYINTGMFSG------------VRPRMMPMLE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 52/238 (22%)
NADB_Rossmann 43..317 CDD:304358 51/235 (22%)
CG15629NP_608859.1 17beta-HSDXI-like_SDR_c 58..298 CDD:187598 50/233 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.