DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and scu

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster


Alignment Length:264 Identity:64/264 - (24%)
Similarity:116/264 - (43%) Gaps:39/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSRELDLSSLDSI 109
            |.:|||..:|:|:.||..:|::|.:|.||....::    ..::.||..::.:|. .:|::|...:
  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSK----GNEVAKELGDKVVFV-PVDVTSEKDV 65

  Fly   110 RKFVDGFKKEQPKLHVLINNAGVMRCPKTLT--------KDGYELQLGVNHIGHFLLTNLLLDVL 166
            ...:...|.:..:|.:.:|.||.....||..        .:.::..:.:|.:|.|.:..|...::
  Fly    66 SAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLM 130

  Fly   167 KNSAPSR------IVVVSSLAHARGSINVADLNSEKSYDEGLAYSQSKLANVLFTRELAKRLEGS 225
            ..:.|::      ||..:|:|...|.|..|            |||.||.|.|..|..:|:.|...
  Fly   131 GANEPNQDGQRGVIVNTASVAAFDGQIGQA------------AYSASKAAVVGMTLPIARDLSTQ 183

  Fly   226 GVTVNALHPGVVDTELARNWAFFQTNLVKFFLKPMIWP-LLKTPKSGAQ--TSIY--AALDPELK 285
            |:.:..:.||:.:|.:.   |.....:..|..|.:.:| .|..|...|.  .:||  ..|:.|:.
  Fly   184 GIRICTIAPGLFNTPML---AALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIYENPLLNGEVI 245

  Fly   286 NISG 289
            .|.|
  Fly   246 RIDG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 64/264 (24%)
NADB_Rossmann 43..317 CDD:304358 64/264 (24%)
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 64/264 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.