DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and Mfe2

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster


Alignment Length:340 Identity:83/340 - (24%)
Similarity:130/340 - (38%) Gaps:86/340 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GKFTKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIF 97
            ||...|    |:|.:||||..|:|:|.||..|.||..|.:            .|:....:.....
  Fly     6 GKLRYD----GRVAVVTGAGAGLGREYALLFAERGAKVVV------------NDLGGTHSGDGAS 54

  Fly    98 SRELDLSSLDSIRK-----------FVDGFK------KEQPKLHVLINNAGVMR---CPKTLTKD 142
            .|..|: .:|.|||           .:||.|      |...::.:|:||||::|   ..||..:|
  Fly    55 QRAADI-VVDEIRKAGGEAVADYNSVIDGAKVIETAIKAFGRVDILVNNAGILRDRSLVKTSEQD 118

  Fly   143 GYELQLGVNHIGHFLLTNLLLDVLKNSAPSRIVVVSSLAHARGSINVADLNSEKSYDEGLAYS-- 205
             :.|...|:..|.|..|......:|.....||::.||.:...|:....:..:.|....|||.:  
  Fly   119 -WNLVNDVHLKGSFKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVA 182

  Fly   206 -----QSKLANVLFTRELAKRLEG--SGVTVNALHPGVVDTELA--------RNWAFFQTNLVKF 255
                 .:.|.||:.....::..||  ..:..|.|.|.::...:|        .|.::.::     
  Fly   183 IEGARNNVLCNVIVPTAASRMTEGILPDILFNELKPKLIAPVVAYLCHESCEDNGSYIES----- 242

  Fly   256 FLKPMIWPLLKTPKSGAQTSIY------AALDPELKN-ISGLYFSDCKPKPVASGALDDKVAKFL 313
                         .:|..|.::      |.|.|.|.: ::..|..|     |.|...|...||.|
  Fly   243 -------------AAGWATKLHMVRGKGAVLRPSLDDPVTIEYVKD-----VWSNVTDMSKAKHL 289

  Fly   314 WAESE-KWTGLDKLE 327
            .|.:| ..|.|:.||
  Fly   290 GAIAEASGTLLEVLE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 76/326 (23%)
NADB_Rossmann 43..317 CDD:304358 75/317 (24%)
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 63/284 (22%)
PRK07791 11..248 CDD:236099 62/272 (23%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.