DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and spidey

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster


Alignment Length:229 Identity:51/229 - (22%)
Similarity:86/229 - (37%) Gaps:53/229 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSRELD 102
            |..:.|:..:|||:..||||..|.|:||||..:.|..|.:.:.....|:|   .:...:..|.:|
  Fly    47 DLSKMGEWAVVTGSTDGIGKAYAKELARRGLKLVLISRSLEKLNVVAKEI---GDKYGVEVRVID 108

  Fly   103 L------SSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNL 161
            :      ...|.||:...|.     .:.||:||.|:                   ..||   ...
  Fly   109 VDFTGGDEIYDKIREKTTGL-----NVGVLVNNVGI-------------------SYGH---PEY 146

  Fly   162 LLDVLKNSAPSRIVVVSSLAHARGSINVADLNSEKSYDEGLAYSQSKLANVL------------- 213
            .||..|...|....:|::..|:...:....|....|...|:..:.|..|.|:             
  Fly   147 FLDCYKADPPFLRNIVAANIHSVTHMTALFLPGMISQRRGVIINVSSTAGVIPNPLLSVYSSTKA 211

  Fly   214 ----FTRELAKRLEGSGVTVNALHPGVVDTELAR 243
                |:.:|....:..|:.:.::.||.|.|.:::
  Fly   212 FVNKFSDDLQTEYKEHGILIQSVQPGFVATNMSK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 50/227 (22%)
NADB_Rossmann 43..317 CDD:304358 50/224 (22%)
spideyNP_572420.1 PLN02780 8..321 CDD:166421 51/229 (22%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 50/224 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447532
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.