DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and Dhrsx

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_006249055.1 Gene:Dhrsx / 288525 RGDID:1305017 Length:331 Species:Rattus norvegicus


Alignment Length:323 Identity:130/323 - (40%)
Similarity:174/323 - (53%) Gaps:18/323 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MWPA----TIGVGIYF--LKEYMQGGKFTKDTD-ETGKVFIVTGANTGIGKETALEIARRGGTVY 71
            :|.|    .:||.:..  |...::||....:.. :..:|.|||||..|:|..||.::||.|..|.
  Rat     5 LWAALRVYAVGVAVTMVQLLRRLRGGFRPPELPLQADRVAIVTGATRGVGLSTACQLARLGMRVI 69

  Fly    72 LACRDMNRCEKARKDIIKETNNQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCP 136
            :|..|.:|..:....|.:|:..::.....|||:||.|:|.||..|:.....||:||||||||..|
  Rat    70 VAGNDEHRGHEVVARIQEESGPESAHFLFLDLASLSSVRSFVRNFEATALPLHLLINNAGVMLDP 134

  Fly   137 KTLTKDGYELQLGVNHIGHFLLTNLLLDVLKNSA----PSRIVVVSSLAHARGSINVADLNSEKS 197
            ...||||:|..:|||.:||||||:|||..|:.|.    .||::.|.|..|..|..:||.|..:..
  Rat   135 SGNTKDGFERHVGVNFLGHFLLTSLLLPALRASGHQGRKSRVITVCSSTHWVGQADVARLLGQSP 199

  Fly   198 YDEGL-AYSQSKLANVLFTRELAKRLE--GSGVTVNALHPGVVDTELARNWAFFQTNLVKFFLKP 259
            ....| ||:.||||..||:..|.:.|.  |..||.|.:.||||||.|..: |.:.|..|:.||. 
  Rat   200 APCALAAYAGSKLALALFSLRLQRLLSALGDPVTANIVDPGVVDTALFAH-AGWGTRAVQRFLG- 262

  Fly   260 MIWPLLKTPKSGAQTSIYAALDPELKNISGLYFSDCKPKPVASGALDDKVAKFLWAESEKWTG 322
              |.|.|||..||.||:|||..|:|:.|.|.|..|.....|...|.|.::...|||||.:.||
  Rat   263 --WLLFKTPDEGAWTSVYAAASPKLEGIGGRYLRDEAEAEVLGAARDLELQGHLWAESCRLTG 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 121/289 (42%)
NADB_Rossmann 43..317 CDD:304358 119/280 (43%)
DhrsxXP_006249055.1 PRK06197 36..326 CDD:235737 123/292 (42%)
NADB_Rossmann 41..315 CDD:304358 116/277 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.