DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rdh1 and K10H10.6

DIOPT Version :10

Sequence 1:NP_610310.2 Gene:Rdh1 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001364610.1 Gene:K10H10.6 / 187285 WormBaseID:WBGene00010762 Length:321 Species:Caenorhabditis elegans


Alignment Length:73 Identity:26/73 - (35%)
Similarity:31/73 - (42%) Gaps:13/73 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 KNNGFGSKNWVYHDSESADVVKQYLQSYYWCTLALTTIGDLPRPRSKAEYVFVIAQLLFGLMLFA 442
            |.||||.      |.|.......|| |||:..:.|..  .||.|....|.:.| ||.|.|   .:
 Worm    87 KGNGFGG------DDEEFRKDPAYL-SYYYANMKLNP--RLPPPLMSREDLRV-AQRLKG---SS 138

  Fly   443 TVLGHVAN 450
            .|||.|.:
 Worm   139 NVLGGVGD 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rdh1NP_610310.2 Rossmann-fold NAD(P)(+)-binding proteins 43..317 CDD:473865
K10H10.6NP_001364610.1 Rossmann-fold NAD(P)(+)-binding proteins 27..304 CDD:473865 26/73 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.