DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and dhs-24

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_507860.3 Gene:dhs-24 / 180306 WormBaseID:WBGene00000987 Length:384 Species:Caenorhabditis elegans


Alignment Length:340 Identity:117/340 - (34%)
Similarity:177/340 - (52%) Gaps:29/340 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IDCLLSPLIMWPATIGV--GIYFLKEYMQGG-KFTKDTDETGKVFIVTGANTGIGKETALEIARR 66
            |..|.||..:..:..|:  |.|.:.:..|.| |:....|..||.:|||||.:|||:.||.|:|:|
 Worm     7 IQGLTSPWSVGFSAFGLAYGGYHVWDSTQSGTKYDLHEDLAGKTYIVTGATSGIGQATAEELAKR 71

  Fly    67 GGTVYLACRDMNRCEKARKDIIKETNNQNIFSRELDLSSLDSIRKFVDGFKK---EQPKLHVLIN 128
            ...|.:|||:..:|.:.|:||:..|.|:.::.|:.||...||||.||....|   |..::..:::
 Worm    72 NARVIMACRNREKCVQVRRDIVLNTRNKQVYCRQCDLEDFDSIRTFVQKLSKGKFELDRIDGIVH 136

  Fly   129 NAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLLD-VLKNSAPSRIVVV-SSLAHARGSINVAD 191
            ||.:|:..:.:.|||.|..:..||:|.||||.|||| :|....|.|||.: |::...:..:|:||
 Worm   137 NAAMMQSERAVNKDGIEKTIATNHLGSFLLTGLLLDKLLAQPNPVRIVFLNSNIIDRKCDLNLAD 201

  Fly   192 LNSE---KSYDEGLAYSQSKLANVLFTRELAKRLEGSGVTVNALHPGVVDTELARNWAFFQTNLV 253
            .|||   |.:|....|..||||:.|||:||::||..:.:.|....||...:.|:.     |.:..
 Worm   202 FNSENAGKKFDGYEIYKHSKLASALFTKELSERLSDTNIHVLMADPGRTKSNLSA-----QMDGQ 261

  Fly   254 KFFLKPMIWPLLKTPKSG---------AQTSIYAALDPELKNISGLYFS-DCKPKPVASGALDDK 308
            .|||..  | |||....|         .:..::|..||:..:.:||:.. :...:|.....:|..
 Worm   262 TFFLSR--W-LLKIVSFGMGERRTEKAVRPVLFALCDPDTSDENGLFIDRERHQQPWNDVIMDAA 323

  Fly   309 VAKFLWAESEKWTGL 323
            ..:.||..|..||.|
 Worm   324 KREKLWNVSVTWTRL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 105/299 (35%)
NADB_Rossmann 43..317 CDD:304358 102/291 (35%)
dhs-24NP_507860.3 FabG 45..306 CDD:223959 99/268 (37%)
retinol-DH_like_SDR_c_like 48..329 CDD:212492 100/288 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.