DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and DHRS13

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_653284.2 Gene:DHRS13 / 147015 HGNCID:28326 Length:377 Species:Homo sapiens


Alignment Length:287 Identity:130/287 - (45%)
Similarity:178/287 - (62%) Gaps:15/287 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSRELDLSSLD 107
            |:..:|||||:||||.||||:||||..|.||||...|.|.|..|:.:|:.|..:....|||:||.
Human    36 GRTAVVTGANSGIGKMTALELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLA 100

  Fly   108 SIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDVLKNSAPS 172
            |:|.|...|...:|:|.:||:|||:..|.:  |::.:.|.|.|||||.||||:|||..||..|||
Human   101 SVRAFATAFLSSEPRLDILIHNAGISSCGR--TREAFNLLLRVNHIGPFLLTHLLLPCLKACAPS 163

  Fly   173 RIVVVSSLAHARGSINVADLNSEKS--YDEGLAYSQSKLANVLFTRELAKRLEGSGVTVNALHPG 235
            |:|||:|.||.||.::...|:....  ..|..||:.:|||||||.||||.:||.:|||..|.|||
Human   164 RVVVVASAAHCRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARELANQLEATGVTCYAAHPG 228

  Fly   236 VVDTEL----ARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGLYFSDCK 296
            .|::||    ...|       ::..|:|:.|.:|:.|:.||||.:|.||...::.:||.||::|.
Human   229 PVNSELFLRHVPGW-------LRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANCH 286

  Fly   297 PKPVASGALDDKVAKFLWAESEKWTGL 323
            .:.|...|.||:.|..||..|::..||
Human   287 VEEVPPAARDDRAAHRLWEASKRLAGL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 128/284 (45%)
NADB_Rossmann 43..317 CDD:304358 127/279 (46%)
DHRS13NP_653284.2 retinol-DH_like_SDR_c_like 36..304 CDD:212492 125/276 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..377 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.