DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and RDH12

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_689656.2 Gene:RDH12 / 145226 HGNCID:19977 Length:316 Species:Homo sapiens


Alignment Length:305 Identity:155/305 - (50%)
Similarity:198/305 - (64%) Gaps:20/305 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LKEYMQGGKFTKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKE 90
            ::::..||....:....|||.::||||||||||||.|:|.||..||:||||:.:.|.|..:|..:
Human    22 IRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELASRGARVYIACRDVLKGESAASEIRVD 86

  Fly    91 TNNQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGH 155
            |.|..:..|:||||...|||.|.:||..|:.:||:||||||||.||.:.|.||:|..|||||:||
Human    87 TKNSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFETHLGVNHLGH 151

  Fly   156 FLLTNLLLDVLKNSAPSRIVVVSSLAHARGSINVADLNSEKSYDEGLAYSQSKLANVLFTRELAK 220
            ||||.|||:.||.|||:|:|.|||:||..|.|...||.|||.|..|.||..||||||||||||||
Human   152 FLLTYLLLERLKVSAPARVVNVSSVAHHIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAK 216

  Fly   221 RLEGSGVTVNALHPGVVDTELARN-------WAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYA 278
            ||:|:|||..|:|||||.:||.|:       |..|.             |.:||.:.|||||::.
Human   217 RLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFS-------------PFVKTAREGAQTSLHC 268

  Fly   279 ALDPELKNISGLYFSDCKPKPVASGALDDKVAKFLWAESEKWTGL 323
            ||...|:.:||.||||||...|:..|.::|.|:.||..|.:..|:
Human   269 ALAEGLEPLSGKYFSDCKRTWVSPRARNNKTAERLWNVSCELLGI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 152/288 (53%)
NADB_Rossmann 43..317 CDD:304358 151/280 (54%)
RDH12NP_689656.2 retinol-DH_like_SDR_c 39..307 CDD:212495 151/280 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm41333
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1905
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.820

Return to query results.
Submit another query.