DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and RDH13

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001139443.1 Gene:RDH13 / 112724 HGNCID:19978 Length:331 Species:Homo sapiens


Alignment Length:317 Identity:170/317 - (53%)
Similarity:214/317 - (67%) Gaps:2/317 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSPLIMWPATIGVGIYFLKEYMQGGKFTKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLA 73
            |.||.......|..: .||:|:.||.........||..|||||||||||:||||:|||||.:.||
Human     5 LLPLSALGTVAGAAV-LLKDYVTGGACPSKATIPGKTVIVTGANTGIGKQTALELARRGGNIILA 68

  Fly    74 CRDMNRCEKARKDIIKETNNQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKT 138
            ||||.:||.|.|||..||.|.::.:|.|||:||.|||:|.....:|:.::.:|||||||||||..
Human    69 CRDMEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHW 133

  Fly   139 LTKDGYELQLGVNHIGHFLLTNLLLDVLKNSAPSRIVVVSSLAHARGSINVADLN-SEKSYDEGL 202
            .|:||:|:|.||||:|||||||||||.||.||||||:.:|||||..|.|:..||| ..:.|:...
Human   134 TTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRKYNTKA 198

  Fly   203 AYSQSKLANVLFTRELAKRLEGSGVTVNALHPGVVDTELARNWAFFQTNLVKFFLKPMIWPLLKT 267
            ||.|||||.||||:||::||:|||||||||||||..|||.|:.....:......|.|:.|.|:|:
Human   199 AYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHTGIHGSTFSSTTLGPIFWLLVKS 263

  Fly   268 PKSGAQTSIYAALDPELKNISGLYFSDCKPKPVASGALDDKVAKFLWAESEKWTGLD 324
            |:..||.|.|.|:..||.::||.||...|.|..|..|.|::||:.|||||.:..||:
Human   264 PELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVARRLWAESARLVGLE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 159/282 (56%)
NADB_Rossmann 43..317 CDD:304358 157/274 (57%)
RDH13NP_001139443.1 retinol-DH_like_SDR_c 38..313 CDD:212495 157/274 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 251 1.000 Domainoid score I2108
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 316 1.000 Inparanoid score I2553
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm41333
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1905
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.