DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and Cbr3

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_766635.1 Gene:Cbr3 / 109857 MGIID:1309992 Length:277 Species:Mus musculus


Alignment Length:280 Identity:79/280 - (28%)
Similarity:119/280 - (42%) Gaps:68/280 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KVFIVTGANTGIGKETALEIARR-GGTVYLACRDMNRCEKARKDIIKETNNQNIFSR--ELDLSS 105
            :|.:|||||.|||.....::.|: .|.|.|..||..|...|    :::...:.:..|  :||:..
Mouse     6 RVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAA----VQQLQAEGLSPRFHQLDIDD 66

  Fly   106 LDSIRKFVDGFKKEQPKLHVLINNAGV---MRCPKTLTKDGYELQLGVNHIGHFLLT-NLLLDVL 166
            ..|||...|..:||...|:||:||||:   |..|..     :::|..|....:|..| |:..::|
Mouse    67 PQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTP-----FDIQAEVTLKTNFFATRNVCTELL 126

  Fly   167 KNSAP-SRIVVVSSLAHARGSIN--------------------------VADLNSEKSYDEG--- 201
            ....| .|:|.:|||...:...|                          |.|..:|....||   
Mouse   127 PIMKPHGRVVNISSLQGLKALENCREDLQEKFRCDTLTEVDLVDLMKKFVEDTKNEVHEREGWPD 191

  Fly   202 LAYSQSKLANVLFTRELAKRLE----GSGVTVNALHPGVVDTELARNWAFFQTNLVKFFLKPMIW 262
            .||..|||...:.||.||::|:    ...:.:||..||.|.|::||:..                
Mouse   192 SAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQG---------------- 240

  Fly   263 PLLKTPKSGAQTSIYAALDP 282
              .:|.:.||:|.:|.||.|
Mouse   241 --SRTVEEGAETPVYLALLP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 79/280 (28%)
NADB_Rossmann 43..317 CDD:304358 79/280 (28%)
Cbr3NP_766635.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 79/280 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.