DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and LOC100497142

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_002932135.3 Gene:LOC100497142 / 100497142 -ID:- Length:352 Species:Xenopus tropicalis


Alignment Length:285 Identity:109/285 - (38%)
Similarity:171/285 - (60%) Gaps:15/285 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSRELDLSSLD 107
            ||..::||..:|||||||:.:|:||..|.:...|..:.:.|.:.|.:|:.:.|:...:|::::|.
 Frog    66 GKTVLITGGTSGIGKETAIALAKRGARVIITNEDEEKGDTALRQIKRESVSMNVKIMKLNMANLQ 130

  Fly   108 SIRKFVDGFKKEQPKLHVLINNAGVMRCPKTL--TKDGYELQLGVNHIGHFLLTNLLLDVLKNSA 170
            |||:|...|.:::.:|.:|||||||   |..|  |.:|:.:..||||:|.||||:||.:.||:.:
 Frog   131 SIREFCKDFVQKEKRLDILINNAGV---PAVLDWTDNGFSMCFGVNHLGTFLLTSLLTERLKSCS 192

  Fly   171 PSRIVVVSSLAHARGSINVADLNSEKSYD--EGLAYSQSKLANVLFTRELAKRLEGSGVTVNALH 233
            |||::.|:|..|....::.||||    |:  ...:|.:||||||.||:|||:::|..|||..|:|
 Frog   193 PSRVITVTSEVHKYQRLDFADLN----YNIVPLFSYCRSKLANVYFTQELARQIERHGVTSCAVH 253

  Fly   234 PGVVDTELARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGLYFSDCKPK 298
            ||.|..:....::.. ..:|.:.:..|.:   .:...|||:.|:.|:..::...:|.|||||||.
 Frog   254 PGYVVGDWTSKFSVL-FRIVMYVISSMFF---ISCLEGAQSVIHCAVSDDILQHNGGYFSDCKPC 314

  Fly   299 PVASGALDDKVAKFLWAESEKWTGL 323
            .:...|.|..:||.||..||...||
 Frog   315 KLRPHAQDTGIAKKLWEVSEIMVGL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 107/282 (38%)
NADB_Rossmann 43..317 CDD:304358 105/277 (38%)
LOC100497142XP_002932135.3 AraJ 11..>59 CDD:225371
NADB_Rossmann 66..333 CDD:419666 105/277 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.