DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and dhrsx

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_002933664.3 Gene:dhrsx / 100487450 XenbaseID:XB-GENE-5952439 Length:327 Species:Xenopus tropicalis


Alignment Length:291 Identity:121/291 - (41%)
Similarity:168/291 - (57%) Gaps:14/291 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSRELDLSS 105
            :.|||.||||...|||..||..::..|..|.:|..:.....:|...|.::|:|:.:.....||:|
 Frog    39 QNGKVAIVTGGAKGIGYSTAKHLSSLGMHVIIAGNNEAEGSEAVTRIQQDTHNEKVEFLYCDLAS 103

  Fly   106 LDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDVLKNSA 170
            :.|||:||..||.:...||||:||||||..|:..|.||:|...|:|::||||||||||...|.|.
 Frog   104 MKSIRQFVQIFKAKNLCLHVLVNNAGVMLVPERKTADGFEEHFGLNYLGHFLLTNLLLKTTKESG 168

  Fly   171 P----SRIVVVSSLAHARGSINVADLNSEKSYDEGLAYSQSKLANVLFTRELAKRL--EGSGVTV 229
            .    :||:.|||..|..|.:|..||||...|....||:|||||.|:||..|.::|  :|..||.
 Frog   169 TENLNARIITVSSATHYVGELNFDDLNSSCCYSPHGAYAQSKLALVMFTYYLQRQLSEDGCYVTA 233

  Fly   230 NALHPGVVDTELARN--WAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGLYF 292
            |.:.||||:|:|.||  |   ...|||:....:.:   ||.:.||.|||||::.|||:.|.|.|.
 Frog   234 NVVDPGVVNTDLYRNVCW---PGRLVKWMAARLFF---KTAEEGAATSIYASVAPELEGIGGCYL 292

  Fly   293 SDCKPKPVASGALDDKVAKFLWAESEKWTGL 323
            .:.:....|..:.::.:.:.||.||.|..|:
 Frog   293 YNGQKTKSADISYNEDLQRKLWNESCKMVGI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 120/288 (42%)
NADB_Rossmann 43..317 CDD:304358 117/281 (42%)
dhrsxXP_002933664.3 retinol-DH_like_SDR_c_like 41..314 CDD:212492 115/278 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.