DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and rdh11

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_031751072.1 Gene:rdh11 / 100485470 XenbaseID:XB-GENE-5943090 Length:327 Species:Xenopus tropicalis


Alignment Length:287 Identity:113/287 - (39%)
Similarity:166/287 - (57%) Gaps:13/287 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSRELDLSSLD 107
            ||..|||||||||||..|:::|||...|.||||...|.::|.::|.::|.|..:....||.||:.
 Frog    42 GKTAIVTGANTGIGKCVAMDLARRNARVILACRSRERGQRALEEIRRQTGNGAVLLEMLDTSSMA 106

  Fly   108 SIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDVLKNSAPS 172
            |:|.|.|...:::.:|.:||||||....|.::|.:|.|.....||:|.|||||||..:::.||||
 Frog   107 SVRAFADRILQQEKRLDILINNAGASGLPHSMTAEGLENTFATNHLGPFLLTNLLTGLMRKSAPS 171

  Fly   173 RIVVVSSLAHARGSINVADLNSE--KSYDEGLAYSQSKLANVLFTRELAKRLEGSGVTVNALHPG 235
            |||.|||..|..|.|:::.|..:  :.:.....|:.|||.|::...|.|:||.|:||||.:|.||
 Frog   172 RIVFVSSFNHKNGEIHLSCLRGQNIRGFRPDYPYNCSKLMNIMCANEFARRLRGTGVTVTSLDPG 236

  Fly   236 VVDTELARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGLYFS-DCK--- 296
            :|.||..|.::.|    ::...|.:.:...:||:.||.::|:.|:..|.:.::..|.. ||.   
 Frog   237 IVMTEAVRYYSIF----IRLIFKSIGFFFFRTPEEGAVSTIFCAVSEEAEGLTEKYIDCDCMLAL 297

  Fly   297 PKPVASGALDDKVAKFLWAESEKWTGL 323
            |.|.|.   |..|...||...|:..||
 Frog   298 PSPAAR---DPPVTAKLWEACEQAVGL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 111/284 (39%)
NADB_Rossmann 43..317 CDD:304358 110/279 (39%)
rdh11XP_031751072.1 NADB_Rossmann 42..313 CDD:419666 109/277 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.