DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and si:dkey-73n8.3

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001186991.1 Gene:si:dkey-73n8.3 / 100150965 ZFINID:ZDB-GENE-141219-27 Length:296 Species:Danio rerio


Alignment Length:284 Identity:141/284 - (49%)
Similarity:188/284 - (66%) Gaps:7/284 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KFTKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFS 98
            :::.|....||..||||||||||||||.::|.||..|.|||||:.:.|:|..||.::..|.|:..
Zfish    11 RWSSDVRLDGKTAIVTGANTGIGKETAKDLANRGARVILACRDLVKAEQAASDISRDVENANVVV 75

  Fly    99 RELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLL 163
            |:|||:...||.:|.:.....:..||:|||||||..||.:.|.||:|.|.||||:|||.||.||:
Zfish    76 RKLDLADTKSICEFAELIYNTEKSLHLLINNAGVAICPYSTTVDGFETQFGVNHLGHFFLTFLLI 140

  Fly   164 DVLKNSAPSRIVVVSSLAHARGSINVADLNSEKSYDEGLAYSQSKLANVLFTRELAKRLEGSGVT 228
            |:||:|||||::.||||.|..|.|:..||||||:|....||.||||||:|||||||.|:|..||.
Zfish   141 DLLKHSAPSRVINVSSLVHPMGKIHFEDLNSEKNYHPVKAYVQSKLANILFTRELASRVEELGVR 205

  Fly   229 VNALHPGVVDTELARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGLYFS 293
            |.|:.||:|:|::.|:    ....|:||:|...: ::|||..||.|::|.||.|:|.  :|.|:|
Zfish   206 VYAVDPGLVNTDITRH----LMKPVQFFVKTFGF-MIKTPAEGAYTTLYCALTPDLP--TGSYYS 263

  Fly   294 DCKPKPVASGALDDKVAKFLWAES 317
            :|.....:..|.||..|..|||.|
Zfish   264 NCAVASCSRAAKDDNSASKLWAVS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 140/278 (50%)
NADB_Rossmann 43..317 CDD:304358 139/273 (51%)
si:dkey-73n8.3NP_001186991.1 PRK06197 19..295 CDD:235737 140/276 (51%)
NADB_Rossmann 20..287 CDD:304358 139/273 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9897
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm6476
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.