DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and wwox

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_017948987.1 Gene:wwox / 100145151 XenbaseID:XB-GENE-5721345 Length:414 Species:Xenopus tropicalis


Alignment Length:301 Identity:126/301 - (41%)
Similarity:179/301 - (59%) Gaps:21/301 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EYMQGGKFTKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETN 92
            |.:||      .|.:|||.||||||||||.|||..:|..|..|.||||::.:..:|:..|::|.:
 Frog   115 EILQG------CDLSGKVVIVTGANTGIGFETARSLALHGTLVILACRNLQKGNEAKHKILEEWH 173

  Fly    93 NQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFL 157
            ...:....|||:||.|::.|.:.||.....|||||.||..:..|..||:||.|:...|||:|||.
 Frog   174 KAKVEVMSLDLASLRSVQSFAEAFKSRNLALHVLICNAAYLGGPWQLTEDGLEMTFQVNHLGHFY 238

  Fly   158 LTNLLLDVLKNSAPSRIVVVSSLAH----ARGSINVADLN----SEKSYDEGLAYSQSKLANVLF 214
            |.:||.|||:.|.|||:|||||.:|    .:.|....|||    .:|.|...|||::|||.|:||
 Frog   239 LVSLLQDVLQRSIPSRVVVVSSESHRFTEIKDSSGKLDLNLLSPLKKDYWAMLAYNRSKLCNILF 303

  Fly   215 TRELAKRLEGSGVTVNALHPG-VVDTELARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYA 278
            ::||.:||...|||.||:||| ::.:.:.|||..:.      .|..::.|..|:.:.||.||:|.
 Frog   304 SKELNRRLSPHGVTSNAVHPGNMMYSSIHRNWWGYT------LLFALVRPFTKSMQQGASTSVYC 362

  Fly   279 ALDPELKNISGLYFSDCKPKPVASGALDDKVAKFLWAESEK 319
            |:.|||:.:.|:||::|.....:..|..::.|..||..||:
 Frog   363 AVSPELEGLGGMYFNNCCRCLPSQEAQREETAAALWELSER 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 123/289 (43%)
NADB_Rossmann 43..317 CDD:304358 120/282 (43%)
wwoxXP_017948987.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.