DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and CBR3

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001227.1 Gene:CBR3 / 874 HGNCID:1549 Length:277 Species:Homo sapiens


Alignment Length:280 Identity:72/280 - (25%)
Similarity:110/280 - (39%) Gaps:68/280 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KVFIVTGANTGIGKETVLEIAKR-GGTVYMACRDMNRCEKARQDIIRETNNQNIFSRELDLSSLE 78
            :|.:|||||.|||.....|:.:: .|.|.:..||:.|.:.|.|.:..|..:...  .:||:..|:
Human     6 RVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQAAVQQLQAEGLSPRF--HQLDIDDLQ 68

  Fly    79 SIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDG-------FEMQLGVNHMGHFLLTHLLLDV 136
            |||......:||...|:||:|||.|     ....|.       .||.|..|......:.:.||.:
Human    69 SIRALRDFLRKEYGGLNVLVNNAAV-----AFKSDDPMPFDIKAEMTLKTNFFATRNMCNELLPI 128

  Fly   137 LKKTAPSRIVNVSSLVHTQGFIKTADLNSEKSYSRI----------------------------- 172
            :|  ...|:||:|||...:.|...::...|:.:|..                             
Human   129 MK--PHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTKNEVHEREGWPN 191

  Fly   173 GAYSQSKLANVLFTRELAKRLE----GTGVTTNSLHPGAVDTELSRNWKFLKHPFAQLLLKPLLW 233
            ..|..|||...:.:|.||:||:    ...:..|:..||.|.|::.....                
Human   192 SPYGVSKLGVTVLSRILARRLDEKRKADRILVNACCPGPVKTDMDGKDS---------------- 240

  Fly   234 VLFKTPRNGAQTTLYAALDP 253
              .:|...||:|.:|.||.|
Human   241 --IRTVEEGAETPVYLALLP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 72/280 (26%)
NADB_Rossmann 14..288 CDD:304358 72/280 (26%)
CBR3NP_001227.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 72/280 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.