DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and AT1G64590

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_176640.1 Gene:AT1G64590 / 842767 AraportID:AT1G64590 Length:334 Species:Arabidopsis thaliana


Alignment Length:295 Identity:111/295 - (37%)
Similarity:157/295 - (53%) Gaps:16/295 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TKQTDETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQNIFSRE 71
            |..:|......|:|||.:|||.||...:||||..:.:..|.:...|:.:..|:.|..:..|....
plant    27 TCNSDLRSLTAIITGATSGIGAETARVLAKRGARLVLPARSVKTAEETKARILSEFPDAEIIVMH 91

  Fly    72 LDLSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDV 136
            ||||||.|:|:|...|:.....|::||||||.......|::||.||....|::||||||.|||..
plant    92 LDLSSLTSVRRFVDDFESLNLPLNILINNAGKYAHKHALSEDGVEMTFATNYLGHFLLTKLLLKK 156

  Fly   137 LKKTA-----PSRIVNVSSLVHT--QGFI--KTADLN-SEKSYSRIGAYSQSKLANVLFTRELAK 191
            :.:||     ..|||||:|:||:  .|.:  ..||:: :.::|....||:.|||||||.|.||::
plant   157 MIETAAQTGVQGRIVNVTSVVHSWFSGDMLQYLADISRNNRNYDATRAYALSKLANVLHTVELSR 221

  Fly   192 RLE--GTGVTTNSLHPGAVDTELSRNWKFLKHPFAQLLLKPLLWVLFKTPRNGAQTTLYAALDPA 254
            .|.  ...||.|.:|||.|.|.|:|:.:.:.......|...||    |:....|.||.|.|..|.
plant   222 LLHKMDANVTANCVHPGIVKTRLTRDREGVVTDLVFFLTSKLL----KSVPQAAATTCYVATSPR 282

  Fly   255 LKDVSGLYFSDCQPKEVSAAAQDDKTGKFLWAESE 289
            |::|.|.|||||.....|.:...:...:.||..|:
plant   283 LRNVCGKYFSDCNEARSSKSGSCNLKAQRLWTASD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 110/291 (38%)
NADB_Rossmann 14..288 CDD:304358 108/285 (38%)
AT1G64590NP_176640.1 retinol-DH_like_SDR_c_like 36..313 CDD:212492 106/280 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm1091
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.