DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and AT4G09750

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_192713.1 Gene:AT4G09750 / 826563 AraportID:AT4G09750 Length:322 Species:Arabidopsis thaliana


Alignment Length:270 Identity:91/270 - (33%)
Similarity:145/270 - (53%) Gaps:23/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQNIFSRELDLSSLE 78
            ||..:|||||:|||......:|.||.||||.||:..|.::|...|...|.|||::....||||:.
plant    43 GKNCVVTGANSGIGFAAAEGLASRGATVYMVCRNKERGQEALSKIQTSTGNQNVYLEVCDLSSVN 107

  Fly    79 SIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDVLKKTAP- 142
            .|:.||:.|..:...:|||:||||::...||.|.:|||:...||.:|.:.:|.|:|.:|:|..| 
plant   108 EIKSFASSFASKDVPVHVLVNNAGLLENKRTTTPEGFELSFAVNVLGTYTMTELMLPLLEKATPD 172

  Fly   143 SRIVNVSSLVHTQGFIKTADLNSEKSYS-----RIGAYSQSKLANVLFTRELAKRLEGTGVTTNS 202
            ::::.|:|     |.:.|:.|.::..:|     .:..|:::|...|..|.:.|.:.:..|:...|
plant   173 AKVITVAS-----GGMYTSPLTTDLQFSGEKFDGVEQYARNKRIQVALTEKWADKYKNKGIGFYS 232

  Fly   203 LHPGAVDTE-LSRNWKFLKHPFAQLLLKPLLWVLFKTPRNGAQTTLYAALDPALKDVSGLYFSDC 266
            :|||..:|. ::::.......||..|         :|...||.|.::.||.|..|.|||.::.|.
plant   233 MHPGWAETPGVAKSLPSFSESFAGKL---------RTSEQGADTIVWLALQPKEKLVSGAFYFDR 288

  Fly   267 --QPKEVSAA 274
              .||.:..|
plant   289 AEAPKHLKLA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 91/270 (34%)
NADB_Rossmann 14..288 CDD:304358 91/270 (34%)
AT4G09750NP_192713.1 FabG 41..283 CDD:223959 86/253 (34%)
NADB_Rossmann 43..298 CDD:304358 90/268 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.