DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and Wwox

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_062519.2 Gene:Wwox / 80707 MGIID:1931237 Length:414 Species:Mus musculus


Alignment Length:305 Identity:118/305 - (38%)
Similarity:173/305 - (56%) Gaps:33/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQGGQFTKQTDETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQ 65
            :||..|      ||||.:|||||:|||.||....|..|..|.:|||:::|..:|...|:.|.:..
Mouse   117 LQGRDF------TGKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHKA 175

  Fly    66 NIFSRELDLSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLT 130
            .:.:..|||:.|.|::.||..||.:...||||:.|||....|..|||||.|....|||:|||.|.
Mouse   176 KVEAMTLDLAVLRSVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLV 240

  Fly   131 HLLLDVLKKTAPSRIVNVSSLVH-------TQGFIKTADLNSEKS-YSRIGAYSQSKLANVLFTR 187
            .||.|||.:::|:|::.|||..|       :.|.:..:.|:..:| |..:.||::|||.|:||:.
Mouse   241 QLLQDVLCRSSPARVIVVSSESHRFTDINDSSGKLDLSRLSPPRSDYWAMLAYNRSKLCNILFSN 305

  Fly   188 ELAKRLEGTGVTTNSLHPG-AVDTELSRN-WKF-----LKHPFAQLLLKPLLWVLFKTPRNGAQT 245
            ||.:||...|||:|::||| .:.:.:.|| |.:     |..||.            |:.:.||.|
Mouse   306 ELHRRLSPRGVTSNAVHPGNMMYSAIHRNSWVYKLLFTLARPFT------------KSMQQGAAT 358

  Fly   246 TLYAALDPALKDVSGLYFSDCQPKEVSAAAQDDKTGKFLWAESEK 290
            |:|.|:.|.|:.:.|:||::|.....|..||.::|.:.||..||:
Mouse   359 TVYCAVAPELEGLGGMYFNNCCRCLPSEEAQSEETARALWELSER 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 115/295 (39%)
NADB_Rossmann 14..288 CDD:304358 112/288 (39%)
WwoxNP_062519.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
WW 19..47 CDD:238122
Nuclear localization signal 50..55
WW 60..90 CDD:238122
PRK06196 107..404 CDD:235736 118/305 (39%)
human_WWOX_like_SDR_c-like 124..407 CDD:187669 114/292 (39%)
Interaction with MAPT. /evidence=ECO:0000269|PubMed:15126504 125..414 113/291 (39%)
Mediates targeting to the mitochondria 209..273 28/63 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.