DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and DHRS12

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001364858.1 Gene:DHRS12 / 79758 HGNCID:25832 Length:320 Species:Homo sapiens


Alignment Length:261 Identity:106/261 - (40%)
Similarity:144/261 - (55%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQNIFSRELDLSSLE 78
            |:||:|||.|:||||.|.||||||||||::.|||....|.||.:||||:.|||||...:|||..:
Human    40 GRVFLVTGGNSGIGKATALEIAKRGGTVHLVCRDQAPAEDARGEIIRESGNQNIFLHIVDLSDPK 104

  Fly    79 SIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDVLKKTAPS 143
            .|.||...||:|. ||||||||||.|...|.||:||.|.....|.:|.::||..|:.||:|....
Human   105 QIWKFVENFKQEH-KLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDP 168

  Fly   144 RIVNVSS---LVHTQGFIKTADLNSEKS-YSRIGAYSQSKLANVLFTRELAKRLEG-TGVTTNSL 203
            |::.|||   ||..   :.|.||.||:: :.....|:|:|...|:.|...|   :| ..:..:|:
Human   169 RVITVSSGGMLVQK---LNTNDLQSERTPFDGTMVYAQNKRQQVVLTERWA---QGHPAIHFSSM 227

  Fly   204 HPGAVDTELSRNWKFLKHPFAQLLLKPLLWVLFKTPRNGAQTTLYAALDPALKDVSGLYFSDCQP 268
            |||..||. .||.:.|:....:                 |||   |:..|...::. ::...|||
Human   228 HPGWADTP-DRNEQELRKVVGE-----------------AQT---ASPLPRFLEIM-MHEGKCQP 270

  Fly   269 K 269
            :
Human   271 Q 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 106/261 (41%)
NADB_Rossmann 14..288 CDD:304358 106/261 (41%)
DHRS12NP_001364858.1 NADB_Rossmann 40..>235 CDD:419666 94/201 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2072
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.