DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and 1700003E16Rik

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_082224.1 Gene:1700003E16Rik / 71837 MGIID:1919087 Length:598 Species:Mus musculus


Alignment Length:217 Identity:44/217 - (20%)
Similarity:82/217 - (37%) Gaps:56/217 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SRELDLSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLL 133
            |..|.:.|.||:|..|.|.:               ::.|::..|....::|..:.......:||.
Mouse   216 SHMLAVPSKESLRSTAEGER---------------VYSPQSSLKQPQVVRLQASEKESSFGSHLS 265

  Fly   134 LDVLKKTAPSRIVNVSSL-VHTQGFIKTADLNSEKSYSRIGAYSQSKLA-----NVLFTRELAKR 192
            |:.|....|........| :.::|.:.::.:.||   |.:||.:.::.:     .||..|...| 
Mouse   266 LEDLYLCMPQPDAAGDRLSLQSKGQLHSSPIGSE---SHLGALTPAEPSAFQEPEVLGERPKHK- 326

  Fly   193 LEGTGVTTNSLHPGAVDTELSRNWKFLKHPFAQLLLKPL----LWVLFKTPRNGAQTTLYAALDP 253
                   |.:|...:  :.|.|:|   ..|.|::|:..|    |.:....||             
Mouse   327 -------TTTLRMDS--SRLPRHW---VRPVAEVLIPDLEVHPLEIYRGRPR------------- 366

  Fly   254 ALKDVSGLYFSDCQPKEVSAAA 275
              :..:|...|.|:.:.:|:.|
Mouse   367 --RSQAGTATSACESQALSSRA 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 44/217 (20%)
NADB_Rossmann 14..288 CDD:304358 44/217 (20%)
1700003E16RikNP_082224.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
DUF4639 6..571 CDD:292118 44/217 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..190
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..241 7/33 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 366..396 6/36 (17%)
LamG <436..>463 CDD:304605
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 551..571
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.