DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and dhrs12la

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_987120.1 Gene:dhrs12la / 677747 ZFINID:ZDB-GENE-030131-8104 Length:320 Species:Danio rerio


Alignment Length:289 Identity:97/289 - (33%)
Similarity:152/289 - (52%) Gaps:35/289 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QFTK---------------QTDETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKA 54
            :|||               :|...|:.|::||||:||||...:.|||:||||:|.||:.::.|:|
Zfish    16 EFTKGAFLSASKNFVEKDLETSMAGRSFMITGANSGIGKAAAMAIAKKGGTVHMVCRNKDKAEEA 80

  Fly    55 RQDIIRETNNQNIFSRELDLSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQL 119
            |.:|::|:.|:.|:...||||..:.:.:|...|||:...|:|||||||.|...|.:..:|.|...
Zfish    81 RAEIVKESGNKEIYVHILDLSETKKVWEFVESFKKKYKTLNVLINNAGCMMTKREVNGEGLEKSF 145

  Fly   120 GVNHMGHFLLTHLLLDVLKKTAPSRIVNVSS---LVHTQGFIKTADLNSEKS-YSRIGAYSQSKL 180
            ..|.:..|:....|:.:|:|:...|::.|||   ||..   ::|.:|.|::. |.....|:|:|.
Zfish   146 ASNSLAVFIFIKSLIPLLEKSPDPRVITVSSGGMLVQK---LRTGNLQSQRGRYDGTMVYAQNKR 207

  Fly   181 ANVLFTRELAKRLEGTGVTTNSLHPGAVDTELSRNWKFLKHPFAQLLLKPLLWVLFKTPRNGAQT 245
            ..|:.|.:.||  ....:..:.:|||.|||....|    ..|.....:|..|    :|...||.|
Zfish   208 QQVVMTEQFAK--AHPSIHFSVMHPGWVDTPTIAN----AMPDFHSSMKERL----RTTEQGADT 262

  Fly   246 TLYAAL-DPALKDVSGLYFSDCQPKEVSA 273
            .::.|: :.|.|:.||.::.|  .|.|||
Zfish   263 VVWLAVSEAAAKNPSGRFYQD--RKMVSA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 93/268 (35%)
NADB_Rossmann 14..288 CDD:304358 93/265 (35%)
dhrs12laNP_987120.1 FabG 37..273 CDD:223959 84/248 (34%)
DHRS-12_like_SDR_c-like 40..294 CDD:187668 93/265 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.