DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and rdh14

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001017231.1 Gene:rdh14 / 549985 XenbaseID:XB-GENE-1018384 Length:323 Species:Xenopus tropicalis


Alignment Length:286 Identity:151/286 - (52%)
Similarity:188/286 - (65%) Gaps:11/286 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQ-NIFSRELDLSSL 77
            ||..|:||||.||||.|..|:.|:...|.:||||..|.|:|..::.||...: .|..::|||.||
 Frog    42 GKTVIITGANCGIGKATAAELVKQEARVILACRDQGRAEEAAAELRREAGERGEIVIKQLDLGSL 106

  Fly    78 ESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDVLKKTAP 142
            :|:|:|.....||:.:|.||||||||..||.|.|:||||||.||||:|||||||.||.:||.:||
 Frog   107 QSVRRFCQEVLKEEPRLDVLINNAGVFQCPYTKTEDGFEMQFGVNHLGHFLLTHHLLGLLKSSAP 171

  Fly   143 SRIVNVSSLVHTQGFIKTADLNSEKSYSRIGAYSQSKLANVLFTRELAKRLEGTGVTTNSLHPGA 207
            ||||.|||.::..|.|...||||||||||...||:|||||:|||||||.||||||||.|:||||.
 Frog   172 SRIVVVSSKLYKYGEINFDDLNSEKSYSRSFGYSRSKLANILFTRELASRLEGTGVTVNALHPGI 236

  Fly   208 VDTELSRNWKFLKHPFAQLLLKPLL----WVLFKTPRNGAQTTLYAALDPALKDVSGLYFSDCQP 268
            |.|.|.|      |....:|:|||.    |..||:|..||||::|.|..|.::.|||.||.:.:.
 Frog   237 VRTNLGR------HINIPILIKPLFNVVSWAFFKSPEEGAQTSIYLASSPEVEGVSGSYFGNSKE 295

  Fly   269 KEVSAAAQDDKTGKFLWAESEKWTGV 294
            :|:...|.||...:.||..||...|:
 Frog   296 EELLPKAMDDLVARKLWDISEVMVGL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 150/284 (53%)
NADB_Rossmann 14..288 CDD:304358 148/278 (53%)
rdh14NP_001017231.1 NADB_Rossmann 42..315 CDD:389744 148/278 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1905
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.