DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and Rdh14

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001102746.1 Gene:Rdh14 / 500629 RGDID:1565196 Length:334 Species:Rattus norvegicus


Alignment Length:295 Identity:145/295 - (49%)
Similarity:188/295 - (63%) Gaps:20/295 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKA----RQDIIR------ETNNQNIF 68
            ||..::||||:|:|:.|..|:.:.|..|.|.|||..|.|:|    ||::.:      :..:..:.
  Rat    44 GKTVLITGANSGLGRATAGELLRLGARVIMGCRDRARAEEAAGQLRQELGQAGGLGPDATDGQLV 108

  Fly    69 SRELDLSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLL 133
            .:||||:||.|:|.|.....:|:.:|.||||||||..||.|.|:||||||.||||:||||||:||
  Rat   109 VKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFQCPYTKTEDGFEMQFGVNHLGHFLLTNLL 173

  Fly   134 LDVLKKTAPSRIVNVSSLVHTQGFIKTADLNSEKSYSRIGAYSQSKLANVLFTRELAKRLEGTGV 198
            |.:||.:||||||.|||.::..|.|...|||||:||::...||:|||||:|||||||.|||||.|
  Rat   174 LGLLKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRELAHRLEGTNV 238

  Fly   199 TTNSLHPGAVDTELSRNWKFLKHPFAQLLLKPLL----WVLFKTPRNGAQTTLYAALDPALKDVS 259
            |.|.||||.|.|.|.|      |....||.:||.    |..||||..||||::|.|..|.::.||
  Rat   239 TVNVLHPGIVRTNLGR------HIHIPLLARPLFNLVSWAFFKTPLEGAQTSIYLASSPDVEGVS 297

  Fly   260 GLYFSDCQPKEVSAAAQDDKTGKFLWAESEKWTGV 294
            |.||.||:.:|:...|.|:...:.||..||...|:
  Rat   298 GRYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 144/293 (49%)
NADB_Rossmann 14..288 CDD:304358 142/287 (49%)
Rdh14NP_001102746.1 PRK06197 43..332 CDD:235737 144/293 (49%)
NADB_Rossmann 44..326 CDD:304358 142/287 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.