DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and rdh13

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001011000.1 Gene:rdh13 / 496409 XenbaseID:XB-GENE-965068 Length:329 Species:Xenopus tropicalis


Alignment Length:289 Identity:154/289 - (53%)
Similarity:199/289 - (68%) Gaps:1/289 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GGQFTKQTDETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQNI 67
            ||....:....|:..|||||||||||||.||:|||||.:.||||||.:||.|.:||..:|.|.|:
 Frog    27 GGNCPSKASIIGQTVIVTGANTGIGKETALELAKRGGRIIMACRDMGKCENAARDIRGKTLNHNV 91

  Fly    68 FSRELDLSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHL 132
            |:|.|||:|.:||::||.....|::::.||||||.||.||...|:|.||||.||||:||||||:|
 Frog    92 FARHLDLASSKSIKEFAKTIINEEERVDVLINNAAVMRCPHWKTEDNFEMQFGVNHLGHFLLTNL 156

  Fly   133 LLDVLKKTAPSRIVNVSSLVHTQGFIKTADLNSE-KSYSRIGAYSQSKLANVLFTRELAKRLEGT 196
            ||:.:|::..|||:|||||.|..|.|...|||.| |.|:...||.||||||||||.||||||:||
 Frog   157 LLEKMKRSENSRIINVSSLAHIAGDIDFDDLNWEKKKYNTKAAYCQSKLANVLFTNELAKRLQGT 221

  Fly   197 GVTTNSLHPGAVDTELSRNWKFLKHPFAQLLLKPLLWVLFKTPRNGAQTTLYAALDPALKDVSGL 261
            .:|.||||||..||||.|:....:..|:..:|.||.|.|.|:|:..||.::|.|:...|:.|||.
 Frog   222 KLTANSLHPGVADTELGRHTGMHQSAFSSTILAPLFWFLVKSPKQAAQPSVYLAVAENLQGVSGK 286

  Fly   262 YFSDCQPKEVSAAAQDDKTGKFLWAESEK 290
            ||:..:.||.:..|.|:::.:.||.||.|
 Frog   287 YFNALKEKEPAPQALDEESARKLWEESAK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 152/281 (54%)
NADB_Rossmann 14..288 CDD:304358 149/274 (54%)
rdh13NP_001011000.1 retinol-DH_like_SDR_c 38..313 CDD:212495 149/274 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 243 1.000 Domainoid score I2166
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 314 1.000 Inparanoid score I2520
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm48536
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.