DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and rdh12l

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001009912.1 Gene:rdh12l / 494176 ZFINID:ZDB-GENE-040801-48 Length:291 Species:Danio rerio


Alignment Length:275 Identity:150/275 - (54%)
Similarity:194/275 - (70%) Gaps:11/275 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQNIFSRELDLSSLE 78
            ||..::|||||||||||.:::||||..:.||||||.:.|.|.:::...:.||::|...||||..:
Zfish    13 GKTVLITGANTGIGKETAIDLAKRGARIIMACRDMEKAEAALKEVKDSSGNQDVFISSLDLSDSK 77

  Fly    79 SIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDVLKKTAPS 143
            |||.||....||:.::::||||||||.||...|.||||||:|||||||||||:||||::|::||:
Zfish    78 SIRGFAEKINKEEKQVNILINNAGVMVCPYGKTADGFEMQIGVNHMGHFLLTYLLLDLIKRSAPA 142

  Fly   144 RIVNVSSLVHTQGFIKTADLNSEKSYSRIGAYSQSKLANVLFTRELAKRLEGTGVTTNSLHPGAV 208
            ||:||||..|..|.|...|:||||:|.:..||.|||||||||||.|||||||||||..|||||.|
Zfish   143 RIINVSSTAHQWGTINLEDINSEKNYDKQKAYCQSKLANVLFTRSLAKRLEGTGVTAYSLHPGVV 207

  Fly   209 DTELSRNWKFLKHPFAQLLLKPLLWV---LFKTPRNGAQTTLYAALDPALKDVSGLYFSDCQPKE 270
            .|:|   |:.|..|     .:.::|.   ..||...||||::|.|:||||:..||.|:|||.|.:
Zfish   208 QTDL---WRHLSKP-----QQAVMWFTKPFTKTSVQGAQTSIYCAVDPALQTESGKYYSDCAPAK 264

  Fly   271 VSAAAQDDKTGKFLW 285
            .:.||.||:..:.||
Zfish   265 AAKAAMDDEVAQRLW 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 150/275 (55%)
NADB_Rossmann 14..288 CDD:304358 150/275 (55%)
rdh12lNP_001009912.1 PRK06197 5..291 CDD:235737 150/275 (55%)
NADB_Rossmann 13..282 CDD:304358 150/275 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 254 1.000 Domainoid score I2017
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 304 1.000 Inparanoid score I2630
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm6476
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.740

Return to query results.
Submit another query.