DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and CG10425

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_651363.1 Gene:CG10425 / 43043 FlyBaseID:FBgn0039304 Length:336 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:109/277 - (39%) Gaps:48/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEK------ARQDIIRETNNQNIFSREL 72
            |:..:|||.:.|||....:|.|.:|..|.:..||    ||      |..::||:..:|....|.|
  Fly    35 GRHVVVTGGSKGIGLCLAVECAMKGANVTVIARD----EKMLSGAVALMEVIRQRPDQKFQYRSL 95

  Fly    73 DLS-SLESIRKFAAGFKKEQDKLHVLINNAGVMHC---PRTLTKDGFEMQLGVNHMGHFLLTHLL 133
            |:| ..:.:.|.....:.....::.|||.||:..|   .....:|..:: :.||..|.:..|..:
  Fly    96 DISGDYDQVAKVLGEIEDSFGPIYTLINCAGMAICGVFEEVSVQDVHKL-MNVNFFGTYNCTRYV 159

  Fly   134 LDVLKKTAPSRIVNVSSLVHTQGFIKTADLNSEKSYSRIGAYSQSKLANVLFTRELA--KRLEGT 196
            |..:||.....||..:|.....|.           |. .|.||.:|.|.......:|  .|..|.
  Fly   160 LPKMKKAGDGIIVITASQAAMFGI-----------YG-YGPYSATKYALRAMAETIAMESREHGV 212

  Fly   197 GVT------TNSLHPGAVDTELS--RNWKFLK--------HPFAQLLLKPLLWVLFKTPRNGAQT 245
            .||      ||:  ||..:.|.|  |..|.:.        ...|:.:||..|...| |...||::
  Fly   213 SVTLAMPCDTNT--PGFEEEEKSKPRETKIISGGGGLIEPEVMAKAILKDALKGKF-TSTVGAES 274

  Fly   246 TLYAALDPALKDVSGLY 262
            .|...|..||....|.:
  Fly   275 WLITTLGGALLPWDGFF 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 74/277 (27%)
NADB_Rossmann 14..288 CDD:304358 74/277 (27%)
CG10425NP_651363.1 KDSR-like_SDR_c 35..271 CDD:187643 67/255 (26%)
adh_short 36..229 CDD:278532 56/211 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447047
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.