DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and cbr1

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_919387.1 Gene:cbr1 / 373866 ZFINID:ZDB-GENE-030902-2 Length:276 Species:Danio rerio


Alignment Length:296 Identity:84/296 - (28%)
Similarity:126/296 - (42%) Gaps:67/296 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KVFIVTGANTGIGKETVLEIAKR-GGTVYMACRDMNRCEKARQDIIRETNNQNIFSRELDLSSLE 78
            ||.:|||||.|||...|..:.|. .|.||::.||:.| ..|..|.:::.....:| .:||::...
Zfish     5 KVALVTGANKGIGFAIVRALCKEYTGDVYLSSRDVGR-GTAAVDSLKKEGLHPLF-HQLDINDPN 67

  Fly    79 SIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLT----HLLLDVLKK 139
            |:|.....|:::...|.|||||||:.......|.  |..|..|....:|..|    ::.|.::| 
Zfish    68 SVRTARDFFQEKYGGLDVLINNAGIAFKMADTTP--FGTQADVTLKTNFFATRDMCNVFLPIIK- 129

  Fly   140 TAPSRIVNVSSLVHT----------------------------QGFIKTAD--LNSEKSYSRIGA 174
             ...|:|||||.:.:                            :.|::.|.  ::||:.:... |
Zfish   130 -PGGRLVNVSSGMGSMALGRCSPELQARFRSDDITEEELNGLMERFVREAQEGVHSERGWPST-A 192

  Fly   175 YSQSKLANVLFT----RELAKRLEGTGVTTNSLHPGAVDTELSRNWKFLKHPFAQLLLKPLLWVL 235
            |..||......|    |.|.|...|.|:..|:..||.|.|:::       .|.|.          
Zfish   193 YGISKTGLTTLTRIQARNLTKERPGDGILCNACCPGWVRTDMA-------GPNAT---------- 240

  Fly   236 FKTPRNGAQTTLYAALDPA-LKDVSGLYFSD--CQP 268
             |:|..||.|.:|.||.|| .|:..|.:.|:  .||
Zfish   241 -KSPDEGAITPVYLALLPAGAKEPHGQFVSEMKVQP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 84/296 (28%)
NADB_Rossmann 14..288 CDD:304358 84/296 (28%)
cbr1NP_919387.1 carb_red_PTCR-like_SDR_c 5..276 CDD:187585 84/296 (28%)
adh_short 5..237 CDD:278532 67/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.