DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and F32A5.8

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_495516.2 Gene:F32A5.8 / 353400 WormBaseID:WBGene00017971 Length:257 Species:Caenorhabditis elegans


Alignment Length:213 Identity:73/213 - (34%)
Similarity:109/213 - (51%) Gaps:14/213 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KQTDETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQNIFSREL 72
            |:.|.:||.:.:||..:|||.||...:|.:|..|.|..|::...||.::.|..|..:..|.....
 Worm    30 KEIDLSGKTYAITGTTSGIGIETARALALKGAHVVMFNRNIVESEKLKKRIEEEKPDVKIDFISC 94

  Fly    73 DLSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDVL 137
            ||:||:|.:..|..|..:...||.||.||||.......|.|.||...||||:..|||...||..|
 Worm    95 DLNSLQSAKAAADEFLSKHWPLHGLILNAGVFAPTVKFTFDNFESHFGVNHLAQFLLAKELLPAL 159

  Fly   138 KKTAPSRIVNVSSLVHTQGFIKTADLNSEK-----------SYSRIGAYSQSKLANVLFTRELAK 191
            ::::|:|||.|||:..:...:|.....|||           .|.::.||  ||:..||...::.:
 Worm   160 RQSSPARIVFVSSVSSSHTGLKAEMTRSEKLNKLCPENANEFYYKLYAY--SKMCQVLTAFKIHR 222

  Fly   192 -RLEGTGVTTNSLHPGAV 208
             .....|::|.::|||.:
 Worm   223 DEFVSHGISTYAIHPGTM 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 72/210 (34%)
NADB_Rossmann 14..288 CDD:304358 71/207 (34%)
F32A5.8NP_495516.2 NADB_Rossmann 36..>245 CDD:304358 71/207 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.