DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and Wwox

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster


Alignment Length:296 Identity:110/296 - (37%)
Similarity:157/296 - (53%) Gaps:33/296 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQNIFSR--ELD 73
            |..|:..::||||.|||.||...:|..|..:..|||:.:..|.|.:.|.:|........|  .||
  Fly   118 DLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALD 182

  Fly    74 LSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDVL- 137
            ||||.|:::|....|:....:..||.||||...|.|.|.||.|....|:|:.||.|| |.|:.| 
  Fly   183 LSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLT-LQLETLF 246

  Fly   138 -KKTAPSRIVNVSSLVHTQGFIKTADL-------NSEKSYSRIGAYSQSKLANVLFTRELAKRLE 194
             .||   ||:.:||..|....:...:|       ..||.:|.: ||:.:||.||||.:|||:|.:
  Fly   247 DYKT---RIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMM-AYNNAKLCNVLFAQELAQRWK 307

  Fly   195 GTGVTTNSLHPG-AVDTELSRNWKFLKHPFAQLLLKPLLWVLFKTPRNGAQTTLYAALDPALKDV 258
            ..|::..||||| .|.::||||:.|.:..||  :::|..    |:.:..|.|::|.|....|..:
  Fly   308 QRGISVFSLHPGNMVSSDLSRNYWFYRLLFA--IVRPFT----KSLQQAAATSIYCATANELTGL 366

  Fly   259 SGLYFSD---CQPKEV--SAAAQDDKTGKFLWAESE 289
            |||||::   |:|.::  |||.|..     ||..||
  Fly   367 SGLYFNNCFFCEPSKLSKSAALQQQ-----LWKLSE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 110/296 (37%)
NADB_Rossmann 14..288 CDD:304358 107/290 (37%)
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 110/296 (37%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 109/293 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I2553
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
87.860

Return to query results.
Submit another query.