DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and Cbr3

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001100580.1 Gene:Cbr3 / 304078 RGDID:1309728 Length:277 Species:Rattus norvegicus


Alignment Length:286 Identity:77/286 - (26%)
Similarity:118/286 - (41%) Gaps:80/286 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KVFIVTGANTGIGKETVLEIAKR-GGTVYMACRDMNRCEKARQDIIRETNNQNIFSR--ELDLSS 76
            :|.:|||||.|||.....::.:: .|.|.:..||..|...|    :::...:.:..|  :||:.:
  Rat     6 RVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAA----VKQLQAEGLSPRFHQLDIDN 66

  Fly    77 LESIRKFAAGFKKEQDKLHVLINNAGV---MHCPRTLTKDGFEMQLGVNHMGHFLLTH----LLL 134
            .:|||......:||...|:||:||||:   |..|..     |::|..|....:|..|.    .||
  Rat    67 PQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTP-----FDVQAEVTLKTNFFATRNVCTELL 126

  Fly   135 DVLKKTAPSRIVNVSSLVHTQGFIKTADLNSEKSYSRI--------------------------- 172
            .::|  ...|:||||||   || :|..:..||....|.                           
  Rat   127 PIMK--PHGRVVNVSSL---QG-LKALENCSEDLQERFRCDTLTEGDLVDLMKKFVEDTKNEVHE 185

  Fly   173 ------GAYSQSKLANVLFTRELAKRLE----GTGVTTNSLHPGAVDTELSRNWKFLKHPFAQLL 227
                  .||..|||...:.||.||::|:    ...:..|:..||.|.|:::|:..          
  Rat   186 REGWPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQG---------- 240

  Fly   228 LKPLLWVLFKTPRNGAQTTLYAALDP 253
                    .:|...||:|.:|.||.|
  Rat   241 --------SRTVEEGAETPVYLALLP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 77/286 (27%)
NADB_Rossmann 14..288 CDD:304358 77/286 (27%)
Cbr3NP_001100580.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 77/286 (27%)
adh_short 6..241 CDD:278532 69/267 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.