DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and Dhrs13

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_038943561.1 Gene:Dhrs13 / 303275 RGDID:1305508 Length:375 Species:Rattus norvegicus


Alignment Length:285 Identity:130/285 - (45%)
Similarity:183/285 - (64%) Gaps:11/285 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQNIFSRELDLSSLE 78
            |:..:|||||:||||.|.||:|:||..|.:|||...|.|.|..|:.:|:.|..:....|||:||.
  Rat    36 GRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLT 100

  Fly    79 SIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDVLKKTAPS 143
            |::.||..|...:.:|.:||:|||:..|.|  |::.|.:.|.|||:|.||||||||..|:..|||
  Rat   101 SVQAFATAFLSSEPRLDILIHNAGISSCGR--TRETFNLLLRVNHVGPFLLTHLLLPRLRSCAPS 163

  Fly   144 RIVNVSSLVHTQGFIKTADLNSEKS--YSRIGAYSQSKLANVLFTRELAKRLEGTGVTTNSLHPG 206
            |:|.|||..|.:|.:....|:....  ...:.||:.||||||||.||||.:|||||||..:.|||
  Rat   164 RVVIVSSAAHRRGRLDFTRLDCPVVGWQQELRAYADSKLANVLFARELATQLEGTGVTCYAAHPG 228

  Fly   207 AVDTELSRNWKFLKH--PFAQLLLKPLLWVLFKTPRNGAQTTLYAALDPALKDVSGLYFSDCQPK 269
            .|::||     ||:|  .:.:.:|:||.|::.:.|:.||||.||.||...::.:||.||::|..:
  Rat   229 PVNSEL-----FLRHLPGWLRPILRPLAWLVLRAPQGGAQTPLYCALQEGIEPLSGRYFANCHVE 288

  Fly   270 EVSAAAQDDKTGKFLWAESEKWTGV 294
            ||||||:||:....||..::|..|:
  Rat   289 EVSAAARDDQAAHRLWKVTKKLAGL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 129/283 (46%)
NADB_Rossmann 14..288 CDD:304358 128/277 (46%)
Dhrs13XP_038943561.1 retinol-DH_like_SDR_c_like 36..304 CDD:212492 126/274 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9094
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.