DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and Wwox

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_006255728.1 Gene:Wwox / 292041 RGDID:1309927 Length:414 Species:Rattus norvegicus


Alignment Length:310 Identity:119/310 - (38%)
Similarity:171/310 - (55%) Gaps:43/310 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQGGQFTKQTDETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQ 65
            :||..|      ||||.:|||||:|||.||....|..|..|.:|||:|:|..:|...|:.|.:..
  Rat   117 LQGRDF------TGKVVLVTGANSGIGFETAKSFALHGAHVILACRNMSRASEAVSRILEEWHKA 175

  Fly    66 NIFSRELDLSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLT 130
            .:.:..|||:.|.|::.||..||.:...||:|:.|||....|.:|||||.|....|||:|||.|.
  Rat   176 KVEAMTLDLAVLRSVQHFAEAFKAKNVPLHILVCNAGTFALPWSLTKDGLETTFQVNHLGHFYLV 240

  Fly   131 HLLLDVLKKTAPSRIVNVSSLVHTQGFIKTADLN-------------SEKSYSRIGAYSQSKLAN 182
            .||.|||.::||:|::.|||..|     :..|:|             |...|..:.||::|||.|
  Rat   241 QLLQDVLCRSAPARVIVVSSESH-----RFTDINDSSGKLDLSRLSLSSSDYWAMLAYNRSKLCN 300

  Fly   183 VLFTRELAKRLEGTGVTTNSLHPG-AVDTELSRN-WKF-----LKHPFAQLLLKPLLWVLFKTPR 240
            :||:.||.:.|...|||:|:|||| .:.:.:.|| |.:     |..||.            |:.:
  Rat   301 ILFSNELHRLLSPRGVTSNALHPGNMMFSAIHRNSWVYKLLFTLARPFT------------KSMQ 353

  Fly   241 NGAQTTLYAALDPALKDVSGLYFSDCQPKEVSAAAQDDKTGKFLWAESEK 290
            .||.||:|.|:.|.|:.:.|:||::|.....|..||:::|.:.||..||:
  Rat   354 QGAATTVYCAVAPELEGLGGMYFNNCCRCLPSEEAQNEETARALWELSER 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 116/300 (39%)
NADB_Rossmann 14..288 CDD:304358 113/293 (39%)
WwoxXP_006255728.1 WW 18..47 CDD:395320
WW 60..90 CDD:238122
human_WWOX_like_SDR_c-like 124..407 CDD:187669 115/297 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.