DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and CG30495

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster


Alignment Length:298 Identity:192/298 - (64%)
Similarity:234/298 - (78%) Gaps:4/298 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQGGQFTKQTDETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQ 65
            ||||:|.|||||||||.||||.|||:|||||:|:|:||.|||||||:..:.|:||::|::||.|.
  Fly    32 MQGGKFRKQTDETGKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNS 96

  Fly    66 NIFSRELDLSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLT 130
            |:||||.|||||:||||||..|||||..||:|||||||...|..|||:||||.|||||:||||||
  Fly    97 NVFSRECDLSSLDSIRKFAENFKKEQRVLHILINNAGVFWEPHRLTKEGFEMHLGVNHIGHFLLT 161

  Fly   131 HLLLDVLKKTAPSRIVNVSSLVHTQGFIKTADLNSEKSYSRIGAYSQSKLANVLFTRELAKRLEG 195
            :|||.||:::||||:|.|:|..|.:|.||..|:||...|....||.||||||:||||||||||||
  Fly   162 NLLLGVLERSAPSRVVVVASRAHERGQIKVDDINSSDFYDEGVAYCQSKLANILFTRELAKRLEG 226

  Fly   196 TGVTTNSLHPGAVDTELSRNWKFLKHPFAQ----LLLKPLLWVLFKTPRNGAQTTLYAALDPALK 256
            ||||.|:|:||..|||::||..|.:..|||    .:|:||||.:.|||:|||||||||||||.|:
  Fly   227 TGVTVNALNPGIADTEIARNMIFFQTKFAQYVVETILRPLLWAVMKTPKNGAQTTLYAALDPDLE 291

  Fly   257 DVSGLYFSDCQPKEVSAAAQDDKTGKFLWAESEKWTGV 294
            .|||.|||||....|:.||.||:..::|||:||||..:
  Fly   292 RVSGQYFSDCALAPVAPAALDDQMAQWLWAQSEKWAKI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 184/286 (64%)
NADB_Rossmann 14..288 CDD:304358 177/277 (64%)
CG30495NP_001260785.1 FabG 44..296 CDD:223959 164/251 (65%)
NADB_Rossmann 45..323 CDD:304358 177/277 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 171 1.000 Domainoid score I1148
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 1 1.000 - - H100724
Inparanoid 1 1.050 219 1.000 Inparanoid score I1212
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm8848
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
1110.870

Return to query results.
Submit another query.