DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and C27D8.4

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_502425.2 Gene:C27D8.4 / 178223 WormBaseID:WBGene00007780 Length:338 Species:Caenorhabditis elegans


Alignment Length:270 Identity:78/270 - (28%)
Similarity:115/270 - (42%) Gaps:37/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQNIFSRELDLSSLESIRK 82
            :|.||:..|||. ::||.:.  .....|..:.....:.....:...|..|:|  :||...|.|..
 Worm    80 LVIGADGTIGKR-IIEILQT--NTDFECHVVVHHHASPIQPFQNDLNTVIYS--VDLKHHEQILL 139

  Fly    83 FAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDVLKK-----TAP 142
            .|...|..|  ..|.|..||:|..|.:.||||.|:...||.:|..:|..||.:..|:     :|.
 Worm   140 LANQLKSHQ--FDVAIFAAGIMLAPESRTKDGVELHNAVNVIGQVMLYELLQNECKRAIFLSSAT 202

  Fly   143 SRIVNVSSLVHTQGFIKTADLNSEKSYS-RIGAYSQSKLANVLFTRELAKRLEGTGVTTNSLHPG 206
            :|:...|           .|.|..|.|: ...||:.|||...::..|:||:..   |.|.|||||
 Worm   203 ARMACYS-----------LDSNFLKVYAGPYQAYASSKLNLAVYVNEVAKKRR---VNTVSLHPG 253

  Fly   207 AVDTELSRNWKFLKHPFAQLLLKPLLWVLFKTPRNGAQTTLYAALDPALKDVSGLYFSDCQ---- 267
            .|...|.:|    .:|..:.|...||..|.:||...|...|:......::  .|.|:.|.|    
 Worm   254 TVPGRLYQN----ANPIVRYLNATLLPKLMRTPEMAAVLVLHTIFRDDIQ--PGAYYEDTQIVNV 312

  Fly   268 PKEVSAAAQD 277
            |:.|.|..::
 Worm   313 PEWVPARERE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 78/270 (29%)
NADB_Rossmann 14..288 CDD:304358 78/270 (29%)
C27D8.4NP_502425.2 NADB_Rossmann 80..313 CDD:389744 75/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.