DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and dhs-1

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_491557.1 Gene:dhs-1 / 172172 WormBaseID:WBGene00000965 Length:323 Species:Caenorhabditis elegans


Alignment Length:251 Identity:84/251 - (33%)
Similarity:128/251 - (50%) Gaps:24/251 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDII---------RETNNQNIFSRELD 73
            :|||:..|:|..|...:.|:|..|.:.|||..|...|.:.::         :|....::|:  ||
 Worm     7 LVTGSTCGLGLHTAKILFKKGANVILTCRDEIRGRHAVESLLSGVSQEQSQKEAERIHLFT--LD 69

  Fly    74 LSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDVLK 138
            :::..||..|.....:....|||:|||||:|..|..|:.||.||....|..||:::...||.:|.
 Worm    70 VTNYNSICNFTDEISRMFKYLHVIINNAGIMGMPFELSVDGIEMHFATNVFGHYVVVERLLPLLL 134

  Fly   139 KT----APSRIVNVSSLVH--TQGFIKTADLNSEKS--YSRIGAYSQSKLANVLFTRELAKRLEG 195
            ||    ..||::.|||.::  .:...:.:.|..:|:  ||...||:.|||||.|:|..|:|.||.
 Worm   135 KTDRPDFKSRVIVVSSGLYRNAEAIPQVSKLLGQKTYDYSPKQAYAFSKLANCLYTGALSKMLEP 199

  Fly   196 TGVTTNSLHPGAVD-TELSRNWKFLKHPFAQLLLKPLLWVLFKTPRNGAQTTLYAA 250
            ..|....:.||.|: |||.|.    .|...:.|..|::|.:.||...|.:|.:|.|
 Worm   200 HNVGVYCVRPGFVNGTELGRE----THWILRALAAPIIWFIAKTLEQGCETIVYLA 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 84/251 (33%)
NADB_Rossmann 14..288 CDD:304358 84/251 (33%)
dhs-1NP_491557.1 adh_short 5..220 CDD:278532 73/214 (34%)
NADB_Rossmann 6..274 CDD:304358 84/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D921996at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.