DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and DHRS13

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_653284.2 Gene:DHRS13 / 147015 HGNCID:28326 Length:377 Species:Homo sapiens


Alignment Length:285 Identity:130/285 - (45%)
Similarity:180/285 - (63%) Gaps:11/285 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQNIFSRELDLSSLE 78
            |:..:|||||:||||.|.||:|:||..|.:|||...|.|.|..|:.:|:.|..:....|||:||.
Human    36 GRTAVVTGANSGIGKMTALELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLA 100

  Fly    79 SIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDVLKKTAPS 143
            |:|.||..|...:.:|.:||:|||:..|.|  |::.|.:.|.|||:|.||||||||..||..|||
Human   101 SVRAFATAFLSSEPRLDILIHNAGISSCGR--TREAFNLLLRVNHIGPFLLTHLLLPCLKACAPS 163

  Fly   144 RIVNVSSLVHTQGFI--KTADLNSEKSYSRIGAYSQSKLANVLFTRELAKRLEGTGVTTNSLHPG 206
            |:|.|:|..|.:|.:  |..|.........:.||:.:|||||||.||||.:||.||||..:.|||
Human   164 RVVVVASAAHCRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARELANQLEATGVTCYAAHPG 228

  Fly   207 AVDTELSRNWKFLKH--PFAQLLLKPLLWVLFKTPRNGAQTTLYAALDPALKDVSGLYFSDCQPK 269
            .|::||     ||:|  .:.:.||:||.|::.:.||.||||.||.||...::.:||.||::|..:
Human   229 PVNSEL-----FLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHVE 288

  Fly   270 EVSAAAQDDKTGKFLWAESEKWTGV 294
            ||..||:||:....||..|::..|:
Human   289 EVPPAARDDRAAHRLWEASKRLAGL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 129/283 (46%)
NADB_Rossmann 14..288 CDD:304358 128/277 (46%)
DHRS13NP_653284.2 retinol-DH_like_SDR_c_like 36..304 CDD:212492 126/274 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..377 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.