DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and RDH13

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001139443.1 Gene:RDH13 / 112724 HGNCID:19978 Length:331 Species:Homo sapiens


Alignment Length:298 Identity:153/298 - (51%)
Similarity:203/298 - (68%) Gaps:1/298 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GGQFTKQTDETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQNI 67
            ||....:....||..|||||||||||:|.||:|:|||.:.:|||||.:||.|.:||..||.|.::
Human    27 GGACPSKATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAKDIRGETLNHHV 91

  Fly    68 FSRELDLSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHL 132
            .:|.|||:||:|||:|||...:|::::.:||||||||.||...|:||||||.||||:||||||:|
Human    92 NARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHWTTEDGFEMQFGVNHLGHFLLTNL 156

  Fly   133 LLDVLKKTAPSRIVNVSSLVHTQGFIKTADLN-SEKSYSRIGAYSQSKLANVLFTRELAKRLEGT 196
            |||.||.:|||||:|:|||.|..|.|...||| ..:.|:...||.|||||.||||:||::||:|:
Human   157 LLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRKYNTKAAYCQSKLAIVLFTKELSRRLQGS 221

  Fly   197 GVTTNSLHPGAVDTELSRNWKFLKHPFAQLLLKPLLWVLFKTPRNGAQTTLYAALDPALKDVSGL 261
            |||.|:||||...|||.|:.......|:...|.|:.|:|.|:|...||.:.|.|:...|.||||.
Human   222 GVTVNALHPGVARTELGRHTGIHGSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGK 286

  Fly   262 YFSDCQPKEVSAAAQDDKTGKFLWAESEKWTGVNSTKV 299
            ||...:.|..:..|:|::..:.|||||.:..|:.:..|
Human   287 YFDGLKQKAPAPEAEDEEVARRLWAESARLVGLEAPSV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 149/283 (53%)
NADB_Rossmann 14..288 CDD:304358 147/274 (54%)
RDH13NP_001139443.1 retinol-DH_like_SDR_c 38..313 CDD:212495 147/274 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 251 1.000 Domainoid score I2108
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 316 1.000 Inparanoid score I2553
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm41333
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1905
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.