DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and dhrsx

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_002933664.3 Gene:dhrsx / 100487450 XenbaseID:XB-GENE-5952439 Length:327 Species:Xenopus tropicalis


Alignment Length:293 Identity:115/293 - (39%)
Similarity:166/293 - (56%) Gaps:18/293 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQNIFSRELDLSS 76
            :.|||.||||...|||..|...::..|..|.:|..:.....:|...|.::|:|:.:.....||:|
 Frog    39 QNGKVAIVTGGAKGIGYSTAKHLSSLGMHVIIAGNNEAEGSEAVTRIQQDTHNEKVEFLYCDLAS 103

  Fly    77 LESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDVLKKTA 141
            ::|||:|...||.:...||||:||||||..|...|.||||...|:|::||||||:|||...|::.
 Frog   104 MKSIRQFVQIFKAKNLCLHVLVNNAGVMLVPERKTADGFEEHFGLNYLGHFLLTNLLLKTTKESG 168

  Fly   142 P----SRIVNVSSLVHTQGFIKTADLNSEKSYSRIGAYSQSKLANVLFTRELAKRL--EGTGVTT 200
            .    :||:.|||..|..|.:...||||...||..|||:|||||.|:||..|.::|  :|..||.
 Frog   169 TENLNARIITVSSATHYVGELNFDDLNSSCCYSPHGAYAQSKLALVMFTYYLQRQLSEDGCYVTA 233

  Fly   201 NSLHPGAVDTELSRN--W--KFLKHPFAQLLLKPLLWVLFKTPRNGAQTTLYAALDPALKDVSGL 261
            |.:.||.|:|:|.||  |  :.:|...|:|        .|||...||.|::||::.|.|:.:.|.
 Frog   234 NVVDPGVVNTDLYRNVCWPGRLVKWMAARL--------FFKTAEEGAATSIYASVAPELEGIGGC 290

  Fly   262 YFSDCQPKEVSAAAQDDKTGKFLWAESEKWTGV 294
            |..:.|..:.:..:.::...:.||.||.|..|:
 Frog   291 YLYNGQKTKSADISYNEDLQRKLWNESCKMVGI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 114/291 (39%)
NADB_Rossmann 14..288 CDD:304358 111/283 (39%)
dhrsxXP_002933664.3 retinol-DH_like_SDR_c_like 41..314 CDD:212492 109/280 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.