DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2065 and wwox

DIOPT Version :9

Sequence 1:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_017948987.1 Gene:wwox / 100145151 XenbaseID:XB-GENE-5721345 Length:414 Species:Xenopus tropicalis


Alignment Length:289 Identity:121/289 - (41%)
Similarity:172/289 - (59%) Gaps:15/289 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRETNNQNIFSRELDLS 75
            |.:|||.||||||||||.||...:|..|..|.:|||::.:..:|:..|:.|.:...:....|||:
 Frog   121 DLSGKVVIVTGANTGIGFETARSLALHGTLVILACRNLQKGNEAKHKILEEWHKAKVEVMSLDLA 185

  Fly    76 SLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDVLKKT 140
            ||.|::.||..||.....|||||.||..:..|..||:||.||...|||:|||.|..||.|||:::
 Frog   186 SLRSVQSFAEAFKSRNLALHVLICNAAYLGGPWQLTEDGLEMTFQVNHLGHFYLVSLLQDVLQRS 250

  Fly   141 APSRIVNVSSLVHTQGFIKTA----DLN----SEKSYSRIGAYSQSKLANVLFTRELAKRLEGTG 197
            .|||:|.|||..|....||.:    |||    .:|.|..:.||::|||.|:||::||.:||...|
 Frog   251 IPSRVVVVSSESHRFTEIKDSSGKLDLNLLSPLKKDYWAMLAYNRSKLCNILFSKELNRRLSPHG 315

  Fly   198 VTTNSLHPG-AVDTELSRNWKFLKHPFAQLLLKPLLWVLFKTPRNGAQTTLYAALDPALKDVSGL 261
            ||:|::||| .:.:.:.|||      :...||..|:....|:.:.||.|::|.|:.|.|:.:.|:
 Frog   316 VTSNAVHPGNMMYSSIHRNW------WGYTLLFALVRPFTKSMQQGASTSVYCAVSPELEGLGGM 374

  Fly   262 YFSDCQPKEVSAAAQDDKTGKFLWAESEK 290
            ||::|.....|..||.::|...||..||:
 Frog   375 YFNNCCRCLPSQEAQREETAAALWELSER 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 121/289 (42%)
NADB_Rossmann 14..288 CDD:304358 118/282 (42%)
wwoxXP_017948987.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.