DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and YKL107W

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_012815.1 Gene:YKL107W / 853753 SGDID:S000001590 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:278 Identity:63/278 - (22%)
Similarity:107/278 - (38%) Gaps:64/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREI--IKATNNQNIFARQLDLCSMK 107
            |||:.|.. |:|:....|||:|.|.|.:..:..:. |:.:.:|  :||           ||..:.
Yeast    26 VAIIGGTG-GLGRAISRELAQRNARVTVVGQTFRD-EDLKDKINFVKA-----------DLSLVS 77

  Fly   108 SIRNFAAGFKREQNKLHILINNAGIM-DCPKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAP 171
            ..:..:...:....:|..||...||. ...:..|.:|.|..:.|:::                  
Yeast    78 ECKRISHSDEIPYEELTHLIFTTGIFASRQRQATSEGLEKDMAVSYL------------------ 124

  Fly   172 SRVVVLSSIAHRFG--RIKRDDL---------------------NSEKSYDRKMAYCQSKLANVL 213
            ||.::...:|.|.|  |.|:|||                     :.||.|.....:..:..||..
Yeast   125 SRYIIFHDVAKRLGISRTKKDDLPKVFIAGFPGNGQVGDPDDLNSDEKKYSAYATHMNTVAANES 189

  Fly   214 FTRELAKRLSGTGVTVNALHPGVVNTELFRNTPFLGS--WFGKLLIAPIIWIFIKTARNGAQTTL 276
            ...:...|.  |.:....|:||::.|.:..|  .|||  :..::....|.|. .::|...|:|..
Yeast   190 LVIDAKDRY--TNIDTFGLNPGLIKTNIRNN--LLGSDTYLSRITEWIISWT-CQSAETYAKTIC 249

  Fly   277 YAALDPSLEKVSGRYFSD 294
            .....|::|..||..||:
Yeast   250 TLIASPAIESRSGTMFSN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 63/278 (23%)
NADB_Rossmann 43..317 CDD:304358 63/278 (23%)
YKL107WNP_012815.1 NADB_Rossmann 26..285 CDD:419666 63/278 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.