DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and AT1G64590

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_176640.1 Gene:AT1G64590 / 842767 AraportID:AT1G64590 Length:334 Species:Arabidopsis thaliana


Alignment Length:328 Identity:113/328 - (34%)
Similarity:156/328 - (47%) Gaps:44/328 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PLAYGSALSAIGIYLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACR 75
            |..:||..:|            ...|..::.....||:||...|||.||...||:|||.:.:..|
plant    14 PSGFGSRSTA------------DHVTCNSDLRSLTAIITGATSGIGAETARVLAKRGARLVLPAR 66

  Fly    76 DMKKCENARREIIKATNNQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAGIMDCPKMLT 140
            .:|..|..:..|:....:..|....|||.|:.|:|.|...|:.....|:|||||||.......|:
plant    67 SVKTAEETKARILSEFPDAEIIVMHLDLSSLTSVRRFVDDFESLNLPLNILINNAGKYAHKHALS 131

  Fly   141 EDGFEMQIGVNHMGHFLLTLLLLDVL-----KSSAPSRVVVLSSIAHRF--GRIKR---DDLNSE 195
            |||.||....|::||||||.|||..:     ::....|:|.::|:.|.:  |.:.:   |...:.
plant   132 EDGVEMTFATNYLGHFLLTKLLLKKMIETAAQTGVQGRIVNVTSVVHSWFSGDMLQYLADISRNN 196

  Fly   196 KSYDRKMAYCQSKLANVLFTRELAKRL--SGTGVTVNALHPGVVNTELFRNTP--------FLGS 250
            ::||...||..|||||||.|.||::.|  ....||.|.:|||:|.|.|.|:..        ||.|
plant   197 RNYDATRAYALSKLANVLHTVELSRLLHKMDANVTANCVHPGIVKTRLTRDREGVVTDLVFFLTS 261

  Fly   251 WFGKLLIAPIIWIFIKTARNGAQTTLYAALDPSLEKVSGRYFSDCKQKHVGSAAQYDDDAQFLWA 315
               |||         |:....|.||.|.|..|.|..|.|:|||||.:.....:...:..||.||.
plant   262 ---KLL---------KSVPQAAATTCYVATSPRLRNVCGKYFSDCNEARSSKSGSCNLKAQRLWT 314

  Fly   316 ESE 318
            .|:
plant   315 ASD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 108/298 (36%)
NADB_Rossmann 43..317 CDD:304358 107/293 (37%)
AT1G64590NP_176640.1 retinol-DH_like_SDR_c_like 36..313 CDD:212492 105/288 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm1091
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.