DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and WWOX

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_057457.1 Gene:WWOX / 51741 HGNCID:12799 Length:414 Species:Homo sapiens


Alignment Length:315 Identity:123/315 - (39%)
Similarity:178/315 - (56%) Gaps:27/315 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YGSALSAIGIYLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMK 78
            |..:.:|:.|      :||..|      ||:|.:|||.|.|||.||....|..||.|.:|||:|.
Human   107 YDGSTTAMEI------LQGRDF------TGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMA 159

  Fly    79 KCENARREIIKATNNQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTEDG 143
            :...|...|::..:...:.|..|||..::|:::||..||.:...||:|:.||.....|..||:||
Human   160 RASEAVSRILEEWHKAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDG 224

  Fly   144 FEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRF-------GRIKRDDLNSEKS-YDR 200
            .|....|||:|||.|..||.|||..|||:||:|:||.:|||       |::....|:..|: |..
Human   225 LETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWA 289

  Fly   201 KMAYCQSKLANVLFTRELAKRLSGTGVTVNALHPG-VVNTELFRNTPFLGSWFGKLLIAPIIWIF 264
            .:||.:|||.|:||:.||.:|||..|||.||:||| ::.:.:.|      ||:...|:..:...|
Human   290 MLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYSNIHR------SWWVYTLLFTLARPF 348

  Fly   265 IKTARNGAQTTLYAALDPSLEKVSGRYFSDCKQKHVGSAAQYDDDAQFLWAESEK 319
            .|:.:.||.||:|.|..|.||.:.|.||::|.:......||.::.|:.|||.||:
Human   349 TKSMQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSER 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 117/288 (41%)
NADB_Rossmann 43..317 CDD:304358 114/282 (40%)
WWOXNP_057457.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
WW 19..47 CDD:238122
Nuclear localization signal. /evidence=ECO:0000250 50..55
WW 60..90 CDD:238122
human_WWOX_like_SDR_c-like 124..407 CDD:187669 116/286 (41%)
Interaction with MAPT. /evidence=ECO:0000250 125..414 115/285 (40%)
Mediates targeting to the mitochondria. /evidence=ECO:0000250 209..273 31/63 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.