DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and LOC500227

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_038964083.1 Gene:LOC500227 / 500227 RGDID:1566019 Length:598 Species:Rattus norvegicus


Alignment Length:121 Identity:25/121 - (20%)
Similarity:39/121 - (32%) Gaps:15/121 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 DVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSEKSYDRKMAYCQSKLANVLFTRELAKRLSGTGVT 228
            :||.....:|.:.:..:..|..::......|:....|..:..|..:......|....|.||...|
  Rat   350 EVLIPDLEARPLEIYRVRPRKSQVGASASESQALGSRTHSKLQVSIPRFPLKRCATFRSSGPDPT 414

  Fly   229 VNALHPGVVNTELFRNTPFLGSWFGKLLIAPIIWIFIKTARNGAQTTLYAALDPSL 284
            :|....   :.....|.|||...|..|            |||.....:.:|..|.|
  Rat   415 LNLAQS---SPSFGSNLPFLSPGFRFL------------ARNLVPPDVASAPSPKL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 25/121 (21%)
NADB_Rossmann 43..317 CDD:304358 25/121 (21%)
LOC500227XP_038964083.1 DUF4639 8..571 CDD:406041 25/121 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.