DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2070 and rdh13

DIOPT Version :9

Sequence 1:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001011000.1 Gene:rdh13 / 496409 XenbaseID:XB-GENE-965068 Length:329 Species:Xenopus tropicalis


Alignment Length:306 Identity:161/306 - (52%)
Similarity:205/306 - (66%) Gaps:3/306 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GSALSAIGIYLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKK 79
            |:||.  |..||:.|..||...:|.:..|:..||||.|.||||||.||||:||..:.||||||.|
 Frog    12 GTALG--GAILLKDYTGGGNCPSKASIIGQTVIVTGANTGIGKETALELAKRGGRIIMACRDMGK 74

  Fly    80 CENARREIIKATNNQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTEDGF 144
            ||||.|:|...|.|.|:|||.|||.|.|||:.||.....|:.::.:|||||.:|.||...|||.|
 Frog    75 CENAARDIRGKTLNHNVFARHLDLASSKSIKEFAKTIINEEERVDVLINNAAVMRCPHWKTEDNF 139

  Fly   145 EMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSE-KSYDRKMAYCQSK 208
            |||.||||:||||||.|||:.:|.|..||::.:||:||..|.|..||||.| |.|:.|.||||||
 Frog   140 EMQFGVNHLGHFLLTNLLLEKMKRSENSRIINVSSLAHIAGDIDFDDLNWEKKKYNTKAAYCQSK 204

  Fly   209 LANVLFTRELAKRLSGTGVTVNALHPGVVNTELFRNTPFLGSWFGKLLIAPIIWIFIKTARNGAQ 273
            |||||||.||||||.||.:|.|:|||||.:|||.|:|....|.|...::||:.|..:|:.:..||
 Frog   205 LANVLFTNELAKRLQGTKLTANSLHPGVADTELGRHTGMHQSAFSSTILAPLFWFLVKSPKQAAQ 269

  Fly   274 TTLYAALDPSLEKVSGRYFSDCKQKHVGSAAQYDDDAQFLWAESEK 319
            .::|.|:..:|:.|||:||:..|:|.....|..::.|:.||.||.|
 Frog   270 PSVYLAVAENLQGVSGKYFNALKEKEPAPQALDEESARKLWEESAK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 151/280 (54%)
NADB_Rossmann 43..317 CDD:304358 148/274 (54%)
rdh13NP_001011000.1 retinol-DH_like_SDR_c 38..313 CDD:212495 148/274 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 243 1.000 Domainoid score I2166
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 314 1.000 Inparanoid score I2520
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm48536
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.